Difference between revisions of "Os03g0170900"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(Labs working on this gene)
Line 31: Line 31:
 
==Labs working on this gene==
 
==Labs working on this gene==
 
Please input related labs here.
 
Please input related labs here.
1. National Institute of Agrobiological Sciences, Kannondai 2-1-2, Tsukuba, Ibaraki, 305-8602 Japan
+
 
2. Hokuriku National Agricultural Experiment Station, 1-2-1 Inada, Joetsu, Niigata, 943-0193 Japan
+
1. National Institute of Agrobiological Sciences, Kannondai 2-1-2, Tsukuba, Ibaraki, 305-8602 Japan.
3. Hokuriku Research Center, National Agricultural Research Center, National Agriculture and Food Research Organization, Joetsu, Niigata 943-0193, Japan
+
 
 +
2. Hokuriku National Agricultural Experiment Station, 1-2-1 Inada, Joetsu, Niigata, 943-0193 Japan.
 +
 
 +
3. Hokuriku Research Center, National Agricultural Research Center, National Agriculture and Food Research Organization, Joetsu, Niigata 943-0193, Japan.
 +
 
 
4. Key Laboratory of Crop Genetics and Physiology of Jiangsu Province, Yangzhou University, Yangzhou, Jiangsu, China.
 
4. Key Laboratory of Crop Genetics and Physiology of Jiangsu Province, Yangzhou University, Yangzhou, Jiangsu, China.
5. Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo 113-8657, Japan
+
 
 +
5. Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo 113-8657, Japan.
 +
 
 
6. CSIRO Plant Industry, Canberra, ACT 2601, Australia.
 
6. CSIRO Plant Industry, Canberra, ACT 2601, Australia.
 +
 
7. Department of Rice Research, National Agricultural Research Center, Joetsu, Niigata, 943-0193 Japan.
 
7. Department of Rice Research, National Agricultural Research Center, Joetsu, Niigata, 943-0193 Japan.
 +
 
8. Shahid  Chamran  University,  College  of  Agriculture,  Department of  Agronomy  and  Plant  Breeding,  P.O.  Box  61357-83151,  Ahwaz,  Iran.
 
8. Shahid  Chamran  University,  College  of  Agriculture,  Department of  Agronomy  and  Plant  Breeding,  P.O.  Box  61357-83151,  Ahwaz,  Iran.
 +
 
9. University  of  California,  San  Diego,  Division  of  Biological  Sciences,  Section  of  Cell  and  Developmental  Biology,  9500  Gilman  Drive  #0116,  Muir Biology  Building,  La  Jolla,  CA  92093,  USA.
 
9. University  of  California,  San  Diego,  Division  of  Biological  Sciences,  Section  of  Cell  and  Developmental  Biology,  9500  Gilman  Drive  #0116,  Muir Biology  Building,  La  Jolla,  CA  92093,  USA.
  

Revision as of 10:07, 10 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. It's the first sucrose transporter gene in rice, rice sucrose transport gene, named OsSUT1. It might not play an important role in carbon metabolism of rice, but participate in the long distance transportation of assimilation product, and plays an important role in the process of sucrose by apoplast pathway. The expression changes of OsSUT1 gene adjusted salt stress response of the Taipei 309 rice varieties (Siahpoosh et al. 2012).

OsSUT1 didn’t directly involve in sucrose transport between epithelial cells in seed scutellum or between aleurone cells during the process of germination. However, in the companion cells and keratin vascular bundle, OsSUT1 may participate in the sucrose loading of phloems to transport to the developing buds and roots. OsSUT1 may also participate in regaining sucrose from the phloem tissue of taproots, coleoptiles and first and second leaves and other parts (Scofield et al., 2007).

Rice sucrose transporters OsSUT1, participate in transport of assimilation product over long distances. OsSUT1 function has been previously tested in the germination and early seedling growth. In this article, the author tested the role of OsSUT1 in assimilate during the whole transport over long distances (from flag blades to the base of the grouting seeds). GUS expression drived by OsSUT1 promoter and immune positioning with OsSUT1 shows that, in the process of grouting, GUS activity and OsSUT1 protein appeared in the mature phloem organized of all the nutrients involved in the assimilation product long-distance transportation way. In addition, OsSUT1 is detected expressing in flag foliage and leaf sheath before earing. GUS activity mainly appeared in the phloem companion cell cell, while its protein in the companion cell and molecular sieve tube. RT-PCR detection showed OsSUT1 transcriptions expressed in the toppest internode (internode 1). The location datas of OsSUT1 is concerned with the starch and sucrose content in these organizations and carbohydrates stored in the stems. In order to detect the connection between the cells, we proceeded the feeding dyeing experiments. The results showed that the symplast between blades of flag leaves, leaf sheath and internode 1 phloem have continuity with parenchyma cells around. Therefore, it’s believed that, during the process of sucrose transport, OsSUT1 may participate in recycling spilled sucrose (Scofield et al., 2007).

Destruction of rice sucrose transporters OsSUT1 damage the function of pollen but does not affect the mature of pollen. As is known to all, in all kinds of sucrose transport steps, sucrose transporters (SUTs) plays an important role in the process of sucrose by apoplast pathway. Due to the developing pollen is symplast separated withanther tissue, SUTs may play a role in the process of sucrose by apoplast pathway. In order to verify this possibility, we anlyze SUT gene family in pubertal pollen of rice by RT-PCR and laser micro-dissection. In five SUT genes, OsSUT1 and OsSUT3 expressed in pollen, while the expression of both have time specificity and are not identical. OsSUT1 are expressed in pollen, determined by using OsSUT1 promoter drive GUS expression. In order to further study OsSUT1 function, we found insertion mutants.Tthe homozygous mutants (SUT1 - / -) can’t be obtained Heterozygous mutants (SUT1 + / -) have grain with normal grouting. However, the lose of OsSUT1 does not affect the starch accumulation in the process of pollen development, suggesting that there may be other sucrose transporters involved in starch biosynthesis (Hirose et al., 2010).

Five sucrose transport gene of rice are expressed in xenopus oocyte and determined by the method of electrophysiology for their activities. It showed that OsSUT1 and OsSUT5 can generate sucrose-dependent electricity through the two electrode voltage clamp technique analysis. We tested the dynamic character of sucrose transport, substrate specificity, PH dependency and sucrose K0.5. OsSUT1 show the similar characteristics with ⅡSUT of all monocotyledon detected before: K0.5 is 7.50 mM, the optimal pH5.6. Compared with OsSUT1, substrate affinity of OsSUT5 is slightly higher (K0.5 is 2.32 mM, the optimal pH5.6). When compared with all Ⅱ SUTs before, substrate specificity of OsSUT5 is a little poorer, pH dependence lower. Meanwhile, the authour detected the regulation of reduced glutathione GSH and oxidized glutathione GSSG for each OsSUTs and ZmSUT1 in corn and HvSUT1 in barley, and found GSH and GSSG had no significant effect on these SUTs activity in xenopus oocyte. In conclusion, transport active differences between OsSUT1 and OsSUT5 has certain scope, which may be adapted to their functions in plants (Sun et al., 2010)

Expression

Please input expression information here. OsSUT1 is expressed highly in the germination of the seed source and ears, lowly in roots (Aoki et al., 2003).

GUS expression drived by OsSUT1 promoter and immune positioning with OsSUT1 shows that, in the process of grouting, GUS activity and OsSUT1 protein appeared in the mature phloem organized of all the nutrients involved in the assimilation product long-distance transportation way. In addition, OsSUT1 is detected expressing in flag foliage and leaf sheath before earing. GUS activity mainly appeared in the phloem companion cell cell, while its protein in the companion cell and molecular sieve tube. (Scofield et al., 2007)

In five SUT genes, OsSUT1 and OsSUT3 expressed in pollen, while the expression of both have time specificity and are not identical. OsSUT1 are expressed in pollen, determined by using OsSUT1 promoter drive GUS expression. (Hirose et al., 2010)

Evolution

Please input evolution information here. Using OsSUT1 and HvSUT2 blast rice genome and get four SUTs, OsSUT2, OsSUT3, OsSUT4 and OsSUT5. These four genes and OsSUT1 constitutes the sucrose transporters of rice gene families. The structure prediction of proteins translated from five SUT genes show that all have 12 transmembrane helical and a domain structure highly conserved in all known SUTs, suggesting the four SUTs coding functional sucrose transporters.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

1. National Institute of Agrobiological Sciences, Kannondai 2-1-2, Tsukuba, Ibaraki, 305-8602 Japan.

2. Hokuriku National Agricultural Experiment Station, 1-2-1 Inada, Joetsu, Niigata, 943-0193 Japan.

3. Hokuriku Research Center, National Agricultural Research Center, National Agriculture and Food Research Organization, Joetsu, Niigata 943-0193, Japan.

4. Key Laboratory of Crop Genetics and Physiology of Jiangsu Province, Yangzhou University, Yangzhou, Jiangsu, China.

5. Graduate School of Agricultural and Life Sciences, The University of Tokyo, Bunkyo-ku, Tokyo 113-8657, Japan.

6. CSIRO Plant Industry, Canberra, ACT 2601, Australia.

7. Department of Rice Research, National Agricultural Research Center, Joetsu, Niigata, 943-0193 Japan.

8. Shahid Chamran University, College of Agriculture, Department of Agronomy and Plant Breeding, P.O. Box 61357-83151, Ahwaz, Iran.

9. University of California, San Diego, Division of Biological Sciences, Section of Cell and Developmental Biology, 9500 Gilman Drive #0116, Muir Biology Building, La Jolla, CA 92093, USA.

References

Please input cited references here. 1. Mohammad R. Siahpoosh;Diego H. Sanchez;Armin Schlereth;Graham N. Scofield;Robert T. Furbank;Joost T. van Dongen;Joachim Kopka

 Modification of OsSUT1 gene expression modulates the salt response of rice Oryza sativa cv. Taipei 309
 Plant Science, 2012, 182: 101-111

2. Tatsuro Hirose;Zujian Zhang;Akio Miyao;Hirohiko Hirochika;Ryu Ohsugi;Tomio Terao

 Disruption of a gene for rice sucrose transporter, OsSUT1, impairs pollen function but pollen maturation is unaffected
 Journal of Experimental Botany, 2010, 61(13): 3639-3646

3. Ye Sun;Anke Reinders;Kathryn R. LaFleur;Toko Mori;John M. Ward

 Transport Activity of Rice Sucrose Transporters OsSUT1 and OsSUT5
 Plant and Cell Physiology, 2010, 51(1): 114-122

4. Graham N. Scofield;Naohiro Aoki;Tatsuro Hirose;Makoto Takano;Colin L. D. Jenkins;Robert T. Furbank

 The role of the sucrose transporter, OsSUT1, in germination and early seedling growth and development of rice plants
 Journal of Experimental Botany, 2007, 58(3): 483-495

5. Graham N. Scofield;Tatsuro Hirose;Naohiro Aoki;Robert T. Furbank

 Involvement of the sucrose transporter, OsSUT1, in the long-distance pathway for assimilate transport in rice
 Journal of Experimental Botany, 2007, 58(12): 3155-3169

6. Naohiro Aoki;Tatsuro Hirose;Graham N. Scofield;Paul R. Whitfeld;Robert T. Furbank

 The Sucrose Transporter Gene Family in Rice
 Plant and Cell Physiology, 2003, 44(3): 223-232

7. Graham N. Scofield;Tatsuro Hirose;Judy A. Gaudron;Robert T. Furbank;Narayana M. Upadhyaya;Ryu Ohsugi

 Antisense suppression of the rice transporter gene, OsSUT1, leads to impaired grain filling and germination but does not affect photosynthesis
 Functional Plant Biology, 2002, 29(7): 815-826

8. Ken Ishimaru;Tatsurou Hirose;Naohiro Aoki;Sakiko Takahashi;Kiyomi Ono;Shinichi Yamamoto;Jiangzhong Wu;Shoko Saji;Tomoya Baba;Masashi Ugaki;Takashi Matsumoto;Ryu Ohsugi

 Antisense Expression of a Rice Sucrose Transporter OsSUT1 in Rice (Oryza sativa L.)
 Plant and Cell Physiology, 2001, 42(10): 1181-1185

Structured Information

Gene Name

Os03g0170900

Description

Sucrose transporter

Version

NM_001055646.1 GI:115451020 GeneID:4331775

Length

6326 bp

Definition

Oryza sativa Japonica Group Os03g0170900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:3776143..3782468

Sequence Coding Region

3776388..3776561,3776678..3776721,3776805..3776868,3776971..3777204,3777314..3777457
,3777576..3777770,3777996..3778071,3778238..3778337,3778504..3778537
,3778625..3778709,3778775..3778839,3778929..3779027,3779359..3779424
,3782034..3782270

Expression

GEO Profiles:Os03g0170900

Genome Context

<gbrowseImage1> name=NC_008396:3776143..3782468 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:3776143..3782468 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggctcgcggcagcggggccggaggaggcggcggcggtggtggcggggggctggagctgtcggtcggggtcggcggcggcggcggcgcgcgtggtgggggaggcggtgaggcggcggcggcggtggagacggcggcgccgatcagcctcgggaggctcatcctctccgggatggtcgccggcggcgtgcagtacgggtgggcgctccagctctccctcctcaccccctacgtccagacactcggactgtcgcatgctcttacttcattcatgtggctctgtggtcctattgctggcatggtggttcaaccatgcgtgggtctatacagtgataggtgcacctcaaaatggggaagacgaaggccatatattcttacaggatgtgtgttgatatgcttggctgtcgtagttattggattttcagctgacattggatacgccatgggtgatacaaaggaagactgcagtgtctaccatggatcacggtggcatgctgctattgtatatgtcctgggattctggcttcttgatttttccaacaacactgtgcagggtccagcacgtgctctaatggctgatttatcaggacgtcatggacctggcacagctaactccatcttctgttcttggatggcaatgggaaacatcctaggatactcctctggttccacaaacaattggcacaagtggtttccattccttaaaacaagagcttgctgtgaagcttgtgcaaatttgaaaggtgcatttctggtggctgtgattttcctgtccctgtgcttggttataactctgatatttgccaaggaagttccattcaaaggaaatgcagccctcccaacaaaatcaaacgagccagctgagcctgaaggcactggtccactagcagtgttgaaaggcttcaggaacttacctactgggatgccttctgtgcttattgtgactggccttacctggttgtcttggttcccattcatcctctacgacactgactggatgggccgtgagatctaccacggtgacccaaagggaactgatcctcagatcgaggctttcaaccagggtgtcagggcaggtgcatttggcctgctactgaattcgattgtgctaggattcagctcattcttgattgaaccaatgtgccggaaagtcgggccaagggtggtgtgggtgacgagcaatttcctcgtctgcatcgccatggctgcaactgcactgatcagcttctggtcactcaaggacttccatggaactgttcagaaagccatcactgcagacaagagcatcaaggctgtctgcctcgtcctctttgcgtttcttggagtccctctcgccgttctgtacagtgttcccttcgcagtgacggcgcaattagcggccactagagggggtggccaagggctctgcaccggcgtcctcaacatctccatcgtcatccctcaggtggtcatcgcgctgggagccgggccgtgggacgagctgttcgggaaggggaacatcccggcgttcggcctcgcctcgggattcgcgctcatcggcggcgtcgccggaatattcctgctgcccaagatctccaagcgccagttccggtcggtcagcatgggcggcggtcactga</cdnaseq>

Protein Sequence

<aaseq>MARGSGAGGGGGGGGGGLELSVGVGGGGGARGGGGGEAAAAVET AAPISLGRLILSGMVAGGVQYGWALQLSLLTPYVQTLGLSHALTSFMWLCGPIAGMVV QPCVGLYSDRCTSKWGRRRPYILTGCVLICLAVVVIGFSADIGYAMGDTKEDCSVYHG SRWHAAIVYVLGFWLLDFSNNTVQGPARALMADLSGRHGPGTANSIFCSWMAMGNILG YSSGSTNNWHKWFPFLKTRACCEACANLKGAFLVAVIFLSLCLVITLIFAKEVPFKGN AALPTKSNEPAEPEGTGPLAVLKGFRNLPTGMPSVLIVTGLTWLSWFPFILYDTDWMG REIYHGDPKGTDPQIEAFNQGVRAGAFGLLLNSIVLGFSSFLIEPMCRKVGPRVVWVT SNFLVCIAMAATALISFWSLKDFHGTVQKAITADKSIKAVCLVLFAFLGVPLAVLYSV PFAVTAQLAATRGGGQGLCTGVLNISIVIPQVVIALGAGPWDELFGKGNIPAFGLASG FALIGGVAGIFLLPKISKRQFRSVSMGGGH</aaseq>

Gene Sequence

<dnaseqindica>5908..6081#5748..5791#5601..5664#5265..5498#5012..5155#4699..4893#4398..4473#4132..4231#3932..3965#3760..3844#3630..3694#3442..3540#3045..3110#199..435#aaacacaaacccaccacctcctcctcctcctcccatccagcacgcgcctcctctctcgcgcggctttccatttccatctccccctcctcctcctacgtctccgccgctcctcacttcctccactcgatttcctttcttggcctctcctcctctgacacaggggtgtgcaggtttgtgtttgtgcgtggcgcgtccgccatggctcgcggcagcggggccggaggaggcggcggcggtggtggcggggggctggagctgtcggtcggggtcggcggcggcggcggcgcgcgtggtgggggaggcggtgaggcggcggcggcggtggagacggcggcgccgatcagcctcgggaggctcatcctctccgggatggtcgccggcggcgtgcagtacgggtgggcgctccagctctccctcctcaccccctacgtccaggtatatatatatatatactgtactcctgtgtattttgcacactctcatgcatgcatctgaaactctgaataatcctgcaaaaaatatatacaagtatctcacgtgtggatttgattttgttcgcgagtttttgctcgtgctagctgttctaatctgcaaggtttcatggtagtagattatatatgtcctggttacaatcttttcaaggttataatcttgtaatttttttctgctttgtcaatatttacttcgcactgtctggtgtgagtcgttaaaaaaatatatatcttgaaagattggggaatttttcttcatgtgtggggagagatttatttttttttgtttgaacggtagatttgactagtgtctaaaagtaccgtaataaattcaatctgcatgccttttgtaattttttttgctcatgtgtttatatacatgtggccaaatatgcatttgatgcactagctatcatttttgtcattttgtagttattccttttcctttcctttttttttcctttttctttttgttgtcactagaggattcatatcctctcgattcctctatgaaacgtcggcgttttctgcctcttttctgaagaatctgtatacctatataagaatcaaaatcttttataagttctttttgtgcactttggatcaatcaggctagccagcatgacacttagcatcagtaccggtctactgtaccgagattcactttacgcttgacacgtttctcaactccttgtttgattccattttacctcaattagactgtttgattccgttttatctcagatatgacactcctttttttaaaattccattttacctcagatgctgtacagtgccataaaaaaatatacatctgctccaactcaccttatccttcttgtaataaccacgtattaggttaatagctactaatagctagagatgtaaacaaaaataagcagacaagggcaaaagtgagcggtaataatggagaattaatctgtcgttcctccgcgcgcagttaaaggtaggcagatgacgggtccctcccctctattccatactaaccgcaagatgaaactaatattcttactgctagatatataaatcatccttcatttagcttcatctccctccttaagatgtgttcttttcttccatttcctaacttctactcccttcgtttgacgtacacatatttcctaaactgccaaacgatgtgtttctactaaaaatttatatggtttaaaaaacatattaatatatttttttttgtctttttagctaatatttaattaattatgtgctaaactaccgctcaattttgtgtaccgggagaaagggttctcaatcattacaaaagaacacagcctagtctccatgaaaaacatcacttttattttaagacagagcaagtggagcgattttataactttactatagtacaaaattaatggtcagaaatttaaaattttgaccgaattttatcgtaagcatcaaatatttattaccggagagatagagtattggttatttgcctctctgtcgtcaaatattctaaacaaagacgatcttcttagtggttaaacttaaatctcagtccttccaggcgtttatttgaaggatttatagcggagataaacagctccttttttttcggaaatacgtaaggagggcacttttgtattaaggggaataaaaagggtctgtacagggaaaaccaaaaaacagcaggggacaggaataaacagctcctcacttcctctttgtatcagtccatactaattaacaaagtgttccaaaatgttctgtactttttctgtagaacattatatgcagttcatcacccctgatggtccatgcatcaggtctagctacctactgttgtattgaagtatttctggcgaagtttatccttaccttagccttctcgagccaagtgccataaagatggttgctgtagaggcaactccaacccactttaaccgcgcacatgaaaaataaaggggtaaaacaaggaaattctaggtcagatatatatgtcctgtggactgtggcacagttgcaacagagcaattgcataggcaaatgagggcagatcatcatgtacccatagcctgttggtgctatgttagcatccaagcattgccattttaactattaagattcttcttcttatatttgacaagtgaaataaatttagtgactgaacatatatagaacgatgaacagtctttgtatgtttattcatgccatgggggaaagagaagtgtgatctgaagttattggatagatagctgttagttgtagcatgcaaggcaatgcatcctggaaccaacagaccaacagagctggggatatttcatctgctaaatttctgggaaaatttattgtgtggtaatcaatatgtgttcactctttgcaactggtacacgctctctgatgtttctgaatatcttccacagtgatgcagatcttgttgacacagcaaactcaacaaacatagtcatttttttaaggaatgaagcatgatcatctattgtcagagtagattacagtcaaagtttttttataagccaaaacaactgattttctaacctctgttatttacagacactcggactgtcgcatgctcttacttcattcatgtggctctgtggtcctattgctggcatggtggtaagtaacaataccaaattatctgctctatcgatatatacgagacaaagcttttgccctcttttaaaaaaaataaatcaaattaattcatgttatggaatctgtactttctgcaatgtaaattcaagttactttagtgtcttcactacaacaaaaacttgggtatcctgaactcctgtatctatcagagtttgaagctgcattttctgtagcttctgatatgtgtaatgtagatcatactgtcataattcataagctttcataaaaaatgtttgtgtacaagtcatattttttttaattcttgatccattatcatctcccaatcctgcaggttcaaccatgcgtgggtctatacagtgataggtgcacctcaaaatggggaagacgaaggccatatattcttacaggatgtgtgttgatatgcttggctgtaagaaccactgaaccttggaactcttattccttaagttgaagtccccaaattttctctcatattgacattgcactttatgtatgtaggtcgtagttattggattttcagctgacattggatacgccatgggtgatacaaaggaagactgcaggtaactgaacattttgcgtatcataattagcagataacagttatctgatacaccatgtaatgcagtgtctaccatggatcacggtggcatgctgctattgtatatgtcctgggattctggcttcttgatttttccaacaacactgtgcaggttagtgcctactatataataatcatgttaaagaaatttgtacaaagaatcataacaaaaatcttaattttgcaatgcaatttctagggtccagcacgtgctctaatggctgatttatcaggtaatttttcatagccttgtctttcagagttaactaccaaatttttattggtttccacagttcactaacacttgattgattccagaaaaaaaaaagttgcccttgtgttctgggcttctggtatcagtgggattttggatttgatctcctaattttcgttctgtaggacgtcatggacctggcacagctaactccatcttctgttcttggatggcaatgggaaacatcctaggatactcctctggttccacaaacaattggcacaagtaagttactcttatgtatcagtttcatacagattttctgtttagcacagtctattcagttgcattcttttctgaaagaaggcaagtgaaattcatattacattagtagagaaggtgaaatttgtttacaagtattgagttgcattctccctaattaattgcgcaggtggtttccattccttaaaacaagagcttgctgtgaagcttgtgcaaatttgaaaggtgcatttctggtggctgtggtaagttctgttattacctcataaactgcctgctgataatactttaacaatgtgctaatattagtctttgtaataagatagtactatactgaaaatattttagcgagtatgagtaatttaacttacatattgtattgctgttcctcttttttcaaccctgtcatattggttgctttttttcacagcctaacatgctcttgtttggtcattttcccctgttttcagattttcctgtccctgtgcttggttataactctgatatttgccaaggaagttccattcaaaggaaatgcagccctcccaacaaaatcaaacgagccagctgagcctgaaggcactggtccactagcagtgttgaaaggcttcaggaacttacctactgggatgccttctgtgcttattgtgactggccttacctgggtatgcaatatacatcagaaaaagaacttttcagattattgaaaaaattgctactagatcatatcttagttatatcttatagtaccttaccttttctatgatatgattgtccttgtagttgtcttggttcccattcatcctctacgacactgactggatgggccgtgagatctaccacggtgacccaaagggaactgatcctcagatcgaggctttcaaccagggtgtcagggcaggtgcatttggcctgctactgaattcggtaagatctgattggtttctgaattctgattgccacaactactgtcaaatctttaacactcaagccatgttctttggcagcaactaaccatgggcttctgatcgtgcagattgtgctaggattcagctcattcttgattgaaccaatgtgccggaaagtcgggccaagggtggtgtgggtgacgagcaatttcctcgtctgcatcgccatggctgcaactgcactgatcagcttctggtcactcaaggacttccatggaactgttcagaaagccatcactgcagacaagagcatcaaggctgtctgcctcgtcctctttgcgtttcttggagtccctctcgccgtaagaatcactgacacttcaacttaaacacattgctaaaaaaaattatttcctcaagaatgccttatcctgatgaactgtctgaaaatttgcgcgatgcaggttctgtacagtgttcccttcgcagtgacggcgcaattagcggccactagagggggtggccaaggtatgaatcccaacattcttgcagcttttcttgacataattcggtgttgtttggatgctggtctaatccatggcgatctgcagggctctgcaccggcgtcctcaacatctccatcgtcatccctcaggttaattagctgccaaattctaatccgtttcccttgaaaccgaatcagatatacttcatggattattagaatttgaatgctcatggattcatggttgcgtggtgttcttccctcaggtggtcatcgcgctgggagccgggccgtgggacgagctgttcgggaaggggaacatcccggcgttcggcctcgcctcgggattcgcgctcatcggcggcgtcgccggaatattcctgctgcccaagatctccaagcgccagttccggtcggtcagcatgggcggcggtcactgaccgccccgctctcgccgccggctgcggcggcggcggcggccggagcagcgccgccggaagtggtgagctttgtagttctcgtttgcaatggatcaaaggagccccctctttttttttacatagggtaattaattaattaaggctgttaattaggaaggggtgaggtggccctgcagctggggcccacgctttgttgccacctcggtagaagagaataagcagatcatgcagataatatggaactg</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0170900, RefSeq:Os03g0170900