Difference between revisions of "Os03g0327800"

From RiceWiki
Jump to: navigation, search
(Mutation and Phenotype)
(other information)
Line 53: Line 53:
 
===other information===
 
===other information===
  
You can also add sub-section(s) at will.
+
*Primers used in this study for molecular cloning of PS1
 +
 
 +
[[File:nap11.jpg]]
 +
 
 +
*Primers used to generate DNA constructs
 +
 
 +
[[File:nap12.jpg]]
 +
[[File:nap13.jpg]]
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 12:48, 1 July 2014

Please input one-sentence summary here.

Annotated Information

Function

  • Os03g0327800 encoding a Oryza sativa NAC-like, activated by apetala3/pistillata (OsNAP). Overexpression of OsNAP significantly promoted senescence, whereas knockdown of OsNAP produced a marked delay of senescence, confirming the role of this gene in the development of rice senescence.
  • ABA Participates in Leaf Senescence and the expression of OsNAP can be induced by ABA. ABA-mediated leaf senescence might be dependent on the modulation of OsNAP expression, which, in turn, either directly or indirectly regulates the expression of senescence-associated genes (SAGs). Also, this is a feedback mechanism between ABA and OsNAP, OsNAP can inhibit the expression of key ABA biosynthesis genes.


Nap1.jpg

Expression

  • OsNAP is expressed preferentially in the leaf blade, leaf sheath, and endosperm with a low, but still detectable, level of expression in the root, culm,

and young panicle.

Nap2.jpg


  • OsNAP transcripts were higher in old, senescing leaves than in young, green leaves.

Nap3.jpg

  • OsNAP expression in flag leaves showed that, although the number of OsNAP transcripts increased gradually before heading, it increased dramatically with the beginning of grain filling.(The red arrow indicates the flowering time)

Nap4.jpg

  • OsNAP expression decreased gradually from the tip to the base of a fully expanded leaf.

Nap5.jpg

  • ABA can induce the expression of OsNAP, and in ABA biosynthetic mutants (aba1 and aba2) the expression is decreased.

Nap6.jpg

Mutation and Phenotype

ps1-D is a dominant mutation caused by the T-DNA insertion.

Nap7.jpg

PS1 contains a typical NAC structure at the N terminus. It belongs to the Va (1)/NAP subfamily of NAC proteins, which has three members in Arabidopsis, six members in rice, and five members in maize. Detailed domain analysis showed that the C-terminal region (amino acids 181–392) possessed high transcriptional activation activity,fragment containing subdomains 3 (amino acids 64–100) and 4 (amino acids 100–142) of the NAC motif showed stronger repression activity, whereas subdomains 1 and 2 (amino acids 1–64) and 5 (amino acids 157–181) exhibited weaker repression activity.

Nap8.jpg

after grain filling, ps1-D mutants had an accelerated yellowing phenotype, displaying senescence 7–10 d earlier than the wild-type plants. In addition, after flowering, ps1-D mutants also exhibited faster chlorophyll degradation than the wild type plants.

Nap9.jpg

OsNAP RNAi lines can delay the senescence.

Nap10.jpg

other information

  • Primers used in this study for molecular cloning of PS1

Nap11.jpg

  • Primers used to generate DNA constructs

Nap12.jpg Nap13.jpg

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os03g0327800

Description

No apical meristem (NAM) protein domain containing protein

Version

NM_001056532.2 GI:297600855 GeneID:4332717

Length

2417 bp

Definition

Oryza sativa Japonica Group Os03g0327800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:12024636..12027052

Sequence Coding Region

12026216..12026613,12026708..12026873

Expression

GEO Profiles:Os03g0327800

Genome Context

<gbrowseImage1> name=NC_008396:12024636..12027052 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:12024636..12027052 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggttctgtcgaacccggcgatgctgccgccggggttccggttccacccgacggacgaggagctgatcgtgcactacctccgcaaccgggccgcctcctcgccgtgccccgtctccatcatcgccgacgtcgacatctacaagttcgatccgtgggacctcccatccaaggagaattacggggacagggagtggtacttcttcagcccgagggaccgcaagtacccgaacgggatccggccgaaccgcgccgcgggctccggctactggaaggccaccggcaccgacaagcccatccacagcagcggcggcgcggcgaccaacgagagcgtcggcgtcaagaaggcgctcgtcttctacaagggccgcccgcccaagggcaccaagaccaactggatcatgcacgagtaccgcctcgccgccgcagacgcccacgccgccaacacctaccgccccatgaagttccgcaacacctccatgagggtaagcaagctccatctacgttacctagcagccagattcaaattatctaaaccaaacaacttaattatgaacaaaccctag</cdnaseq>

Protein Sequence

<aaseq>MVLSNPAMLPPGFRFHPTDEELIVHYLRNRAASSPCPVSIIADV DIYKFDPWDLPSKENYGDREWYFFSPRDRKYPNGIRPNRAAGSGYWKATGTDKPIHSS GGAATNESVGVKKALVFYKGRPPKGTKTNWIMHEYRLAAADAHAANTYRPMKFRNTSM RVSKLHLRYLAARFKLSKPNNLIMNKP</aaseq>

Gene Sequence

<dnaseqindica>440..837#180..345#aaattcgagccctcctccatctctcgcctcctcttgatacaagctcgaccctgatagatctcatagatcatagctgagaggggatcgagtggcttgatcttggaagtgagcagctatagctagataggttttgcttgtgcagggaggtgtgtgttgtgtgtgggtgactgccggagacgatggttctgtcgaacccggcgatgctgccgccggggttccggttccacccgacggacgaggagctgatcgtgcactacctccgcaaccgggccgcctcctcgccgtgccccgtctccatcatcgccgacgtcgacatctacaagttcgatccgtgggacctcccatgttagtacccaccctcacagctcgccgcgatcgatcgatcactgatttgcaattaatttcgttggtgatcgacttgtgttttgatttgcatcagccaaggagaattacggggacagggagtggtacttcttcagcccgagggaccgcaagtacccgaacgggatccggccgaaccgcgccgcgggctccggctactggaaggccaccggcaccgacaagcccatccacagcagcggcggcgcggcgaccaacgagagcgtcggcgtcaagaaggcgctcgtcttctacaagggccgcccgcccaagggcaccaagaccaactggatcatgcacgagtaccgcctcgccgccgcagacgcccacgccgccaacacctaccgccccatgaagttccgcaacacctccatgagggtaagcaagctccatctacgttacctagcagccagattcaaattatctaaaccaaacaacttaattatgaacaaaccctagcagctggatcttgctatcgatggagtagagagtagatcgtctattattcatctctgtctgatgtgctagtgcacttgcacagttgcacaccgtggtttttttgggtggttgtttctgatgatcgatacgtgttcgtcggcacgtcagtattatcgcatcggtttgtgccttgccaatggacgcaactcgctgcttttagtgtgtctgttttaaagagggtgttctttaggcaatacttggcatggttgcgcaagtcaatagatccgacaatgatagccacgatgcgtacgtgttgatgactggttcatctctgcatatgcgcgcatgcataccccctgaaattaatcccttctatttttgatactcttaatttcttaatcatatagtatatgcatccgtgtgattgatcgatcgatgtgcgtggatttttgtgcagctggatgactgggtgctgtgccggatctacaagaagagcagccacgcgtcgccgctggccgtgccgccgctctccgaccacgagcaggacgagccgtgcgccctggaggagaacgcgccgctgtacgcgccgtcgtcgtcgagcgccgcatccatgatcttgcagggcgctgccgccggcgccttcccgtcgctgcacgccgccgccgccgctacgcagaggacggcgatgcagaagatcccttccatttccgacctgctcaacgagtactcgctgtcgcagctcttcgacgacggcggcgccgccgccgccgcccccctgcaggagatggcgaggcagcccgaccaccaccaccaccaacaacaacaacacgccctctttggccaccccgtcatgaaccatttcatcgcgaacaacagcatggttcagctcgcgcacctggacccgtcctcctctgcggccgcctcgacgtcggcaggcgccgtcgtcgagccgccggccgtcaccgggaagcgcaagagatcatcggacggaggcgagccgacgatccaggcgctgcctcctgctgccgcggcggccaagaagccgaacggttcatgcgttggtgcaactttccaaataggcagcgccttgcagggatcgtcactgggactgagccaccagatgctgctccactctaacatggggatgaactgatagctcgttcttcgtacataataccacagcctgattaaacactgaacataattgcacatggcgaattgatgatttgaacagtgaggtctatttcgaaagcaaataggtccaaaacgatagatttaaatagtaaatatattgggaaagaaattgtacttaatttgtacttgtgtggactagctaggtcgtccgatcatgcatagctatatagtttgtggtgtgtatacattttttctcatggtactatactactgtgtactcaagctagctcagtactaaagattaattaagctagataggggttgataagactttgagatagacccactagaagtctggaacatgagatcaaggagaatgatgtcaagatcataaagccggatttatagctcatattcatgtaaatcaatcaataagtgattctttaatggcagccactcattttttt</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0327800, RefSeq:Os03g0327800