Difference between revisions of "Os01g0311700"
(Created page with "{{JaponicaGene|
GeneName = Os01g0311700|
Description = Pectinesterase inhibitor domain containing protein|
Version = NM_001049399.1 GI:115436211 GeneID:4327281|
Length = 1...") |
|||
| Line 1: | Line 1: | ||
| + | Please input one-sentence summary here. | ||
| + | |||
| + | ==Annotated Information== | ||
| + | ===Function=== | ||
| + | Please input function information here. | ||
| + | |||
| + | ===Expression=== | ||
| + | Please input expression information here. | ||
| + | |||
| + | ===Evolution=== | ||
| + | Please input evolution information here. | ||
| + | |||
| + | You can also add sub-section(s) at will. | ||
| + | |||
| + | ==Labs working on this gene== | ||
| + | Please input related labs here. | ||
| + | |||
| + | ==References== | ||
| + | Please input cited references here. | ||
| + | |||
| + | ==Structured Information== | ||
{{JaponicaGene| | {{JaponicaGene| | ||
GeneName = Os01g0311700| | GeneName = Os01g0311700| | ||
Revision as of 18:49, 22 July 2012
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os01g0311700 |
|---|---|
| Description |
Pectinesterase inhibitor domain containing protein |
| Version |
NM_001049399.1 GI:115436211 GeneID:4327281 |
| Length |
1025 bp |
| Definition |
Oryza sativa Japonica Group Os01g0311700, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:11856309..11857333 |
| Sequence Coding Region |
11856387..11856733,11856858..11857101 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:11856309..11857333 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:11856309..11857333 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcttcctccccgtatcacgccgccgtcggtgtcgccgtccttgccatcctcctcgccgcgccggctgcggaggccggggcacctaccgccgcgccgttggccaactactccctcgaggacgcgtgcaagaagaccggcccacactacggcctctgcatcgtgacgctctccgccgaccggtccgccaagtcgtcggacacggtggggctcgccagggtggccgtcctggcggcgcagaagaacgcgtcggagacggccacctacctctccagcatctacgacgacgacagcatcgagaagaagacggtgcagctgcagcagtgcctcgaggactgctccgagaggtacgaggcggcggtggagcagctgacggacgcgacggtggcgctggacacgggggggtacgaggaggcgatggcgctggtggcggcggggcaggcggaggtgaagatgtgccagagggggttcaaggccgtgccgcagcaccggaacatcctcaccttgcgcaaccgcgaggtcgaccagctctgcagcatcgccttcaccatcaccaagctgatccgcgtgtcaccgagcgctgaagaatag</cdnaseq> |
| Protein Sequence |
<aaseq>MASSPYHAAVGVAVLAILLAAPAAEAGAPTAAPLANYSLEDACK KTGPHYGLCIVTLSADRSAKSSDTVGLARVAVLAAQKNASETATYLSSIYDDDSIEKK TVQLQQCLEDCSERYEAAVEQLTDATVALDTGGYEEAMALVAAGQAEVKMCQRGFKAV PQHRNILTLRNREVDQLCSIAFTITKLIRVSPSAEE</aaseq> |
| Gene Sequence |
<dnaseqindica>79..425#550..793#gcgtccaacgtgagcaacatcaccgaagccggtcgctgatcggaggaaaacccaaaaaagaaagaaaaaaacgacgaaatggcttcctccccgtatcacgccgccgtcggtgtcgccgtccttgccatcctcctcgccgcgccggctgcggaggccggggcacctaccgccgcgccgttggccaactactccctcgaggacgcgtgcaagaagaccggcccacactacggcctctgcatcgtgacgctctccgccgaccggtccgccaagtcgtcggacacggtggggctcgccagggtggccgtcctggcggcgcagaagaacgcgtcggagacggccacctacctctccagcatctacgacgacgacagcatcgagaagaagacggtgcagctgcagcagtgcctcgaggactgctccgagaggtaacgtgttttcgtcgtatacgcaacgagaatcaatacacacgtacgccgggcgccggctatcgatggttgggtgccaggcgcgatgaatgaccggtgttgtacgtacgctgtggtgatgaaggtacgaggcggcggtggagcagctgacggacgcgacggtggcgctggacacgggggggtacgaggaggcgatggcgctggtggcggcggggcaggcggaggtgaagatgtgccagagggggttcaaggccgtgccgcagcaccggaacatcctcaccttgcgcaaccgcgaggtcgaccagctctgcagcatcgccttcaccatcaccaagctgatccgcgtgtcaccgagcgctgaagaatagctttctcttcttccttttatcccctggatattcttttttattttttcgacgacaggggtaatctgggattccatggttggaagattagcatgtttgttgatggctttgaattggattggtaattgctgtttgcatcagcagacaacatcctaggcgctggcggtggtggaactgttgttgggttcatacgatcaatgtatagcacattcttgatcttaaaaagagcattgct</dnaseqindica> |
| External Link(s) |