Difference between revisions of "PetG"
(Created page with "{{Plastid| GeneName = petG| Description = cytochrome b6/f complex subunit V| Version = GeneID:3131405| Length = 114 bp| Definition = Oryza sativa Japonica Group ''petG'', Plas...") |
|||
| Line 15: | Line 15: | ||
AP = Plastid:63799..63912| | AP = Plastid:63799..63912| | ||
CDS = 63799..63912| | CDS = 63799..63912| | ||
| − | GCID = < | + | GCID = <gbrowseImage3> |
name=NC_001320:63799..63912 | name=NC_001320:63799..63912 | ||
source=Rice_Japonica_Plastid | source=Rice_Japonica_Plastid | ||
preset=GeneLocation | preset=GeneLocation | ||
| − | </ | + | </gbrowseImage3>| |
GSID = <gbrowseImage2> | GSID = <gbrowseImage2> | ||
name=NC_001320:63799..63912 | name=NC_001320:63799..63912 | ||
| Line 27: | Line 27: | ||
AA = <aaseq>MIEVFLFGIVLGLIPITLAGLFVTAYLQYRRGDQLDL</aaseq>| | AA = <aaseq>MIEVFLFGIVLGLIPITLAGLFVTAYLQYRRGDQLDL</aaseq>| | ||
DNA = <dnaseqindica>1..114#atgattgaagtttttctatttggaatcgtcttaggcctaattcctattactttagcgggattattcgtgactgcgtatttgcaatacagacgtggggatcagttggatctttga</dnaseqindica>| | DNA = <dnaseqindica>1..114#atgattgaagtttttctatttggaatcgtcttaggcctaattcctattactttagcgggattattcgtgactgcgtatttgcaatacagacgtggggatcagttggatctttga</dnaseqindica>| | ||
| + | Link = [http://www.ncbi.nlm.nih.gov/gene?term=3131405 NCBI Gene:petG] | ||
}} | }} | ||
[[Category:Genes]] | [[Category:Genes]] | ||
Revision as of 14:48, 23 October 2012
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
petG |
|---|---|
| Description |
cytochrome b6/f complex subunit V |
| Version |
GeneID:3131405 |
| Length |
114 bp |
| Definition |
Oryza sativa Japonica Group petG, Plastid gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Plastid:63799..63912 |
| Sequence Coding Region |
63799..63912 |
| Genome Context |
<gbrowseImage3> name=NC_001320:63799..63912 source=Rice_Japonica_Plastid preset=GeneLocation </gbrowseImage3> |
| Gene Structure |
<gbrowseImage2> name=NC_001320:63799..63912 source=Rice_Japonica_Plastid preset=GeneLocation </gbrowseImage2> |
| Protein Sequence |
<aaseq>MIEVFLFGIVLGLIPITLAGLFVTAYLQYRRGDQLDL</aaseq> |
| Gene Sequence |
<dnaseqindica>1..114#atgattgaagtttttctatttggaatcgtcttaggcctaattcctattactttagcgggattattcgtgactgcgtatttgcaatacagacgtggggatcagttggatctttga</dnaseqindica> |
| External Link(s) |