Difference between revisions of "Os01g0907900"

From RiceWiki
Jump to: navigation, search
(References)
(References)
Line 68: Line 68:
 
==References==
 
==References==
 
<references>
 
<references>
<ref name="21318372">Qiao, Y; Piao, R; Shi, J; Lee, SI; Jiang, W; Kim, BK; Lee, J; Han, L; Ma, W; Koh, HJ. (2011) Fine mapping and candidate gene analysis of dense and erect panicle 3, DEP3, which confers high grain yield in rice (Oryza sativa L.).TAG. Theoretical and applied genetics. Theoretische und angewandte Genetik 122: 7.</ref>
+
<ref name="pmid:21318372">Qiao, Y; Piao, R; Shi, J; Lee, SI; Jiang, W; Kim, BK; Lee, J; Han, L; Ma, W; Koh, HJ. (2011) Fine mapping and candidate gene analysis of dense and erect panicle 3, DEP3, which confers high grain yield in rice (Oryza sativa L.).TAG. Theoretical and applied genetics. Theoretische und angewandte Genetik 122: 7.</ref>
<ref name="16541125">Xiong, GS; Hu, XM; Jiao, YQ; Yu, YC; Chu, CC; Li, JY; Qian, Q; Wang, YH. (2006) Leafy head2, which encodes a putative RNA-binding protein, regulates shoot development of rice.Cell research 16: 3.</ref>
+
<ref name="pmid:16541125">Xiong, GS; Hu, XM; Jiao, YQ; Yu, YC; Chu, CC; Li, JY; Qian, Q; Wang, YH. (2006) Leafy head2, which encodes a putative RNA-binding protein, regulates shoot development of rice.Cell research 16: 3.</ref>
<ref name="16461585">Kawakatsu, T; Itoh, J; Miyoshi, K; Kurata, N; Alvarez, N; Veit, B; Nagato, Y. (2006) PLASTOCHRON2 regulates leaf initiation and maturation in rice.The Plant cell 18: 3.</ref>
+
<ref name="pmid:16461585">Kawakatsu, T; Itoh, J; Miyoshi, K; Kurata, N; Alvarez, N; Veit, B; Nagato, Y. (2006) PLASTOCHRON2 regulates leaf initiation and maturation in rice.The Plant cell 18: 3.</ref>
<ref name="9576789">Ståhl, U; Ek, B; Stymne, S. (1998) Purification and characterization of a low-molecular-weight phospholipase A2 from developing seeds of elm.Plant physiology 117: 1.</ref>
+
<ref name="pmid:9576789">Ståhl, U; Ek, B; Stymne, S. (1998) Purification and characterization of a low-molecular-weight phospholipase A2 from developing seeds of elm.Plant physiology 117: 1.</ref>
<ref name="19457861">Guy, JE; Ståhl, U; Lindqvist, Y. (2009) Crystal structure of a class XIB phospholipase A2 (PLA2): rice (oryza sativa) isoform-2 pla2 and an octanoate complex.The Journal of biological chemistry 284: 29.</ref>
+
<ref name="pmid:19457861">Guy, JE; Ståhl, U; Lindqvist, Y. (2009) Crystal structure of a class XIB phospholipase A2 (PLA2): rice (oryza sativa) isoform-2 pla2 and an octanoate complex.The Journal of biological chemistry 284: 29.</ref>
<ref name="17111113">Zhu, QH; Dennis, ES; Upadhyaya, NM. (2007) Compact shoot and leafy head 1, a mutation affects leaf initiation and developmental transition in rice (Oryza sativa L).Plant cell reports 26: 4.</ref>
+
<ref name="pmid:17111113">Zhu, QH; Dennis, ES; Upadhyaya, NM. (2007) Compact shoot and leafy head 1, a mutation affects leaf initiation and developmental transition in rice (Oryza sativa L).Plant cell reports 26: 4.</ref>
<ref name="22476293">Mimura, M; Nagato, Y; Itoh, J. (2012) Rice PLASTOCHRON genes regulate leaf maturation downstream of the gibberellin signal transduction pathway.Planta 235: 5.</ref>
+
<ref name="pmid:22476293">Mimura, M; Nagato, Y; Itoh, J. (2012) Rice PLASTOCHRON genes regulate leaf maturation downstream of the gibberellin signal transduction pathway.Planta 235: 5.</ref>
<ref name="19228340">Kawakatsu, T; Taramino, G; Itoh, J; Allen, J; Sato, Y; Hong, SK; Yule, R; Nagasawa, N; Kojima, M; Kusaba, M; Sakakibara, H; Sakai, H; Nagato, Y. (2009) PLASTOCHRON3/GOLIATH encodes a glutamate carboxypeptidase required for proper development in rice.The Plant journal : for cell and molecular biology 58: 6.</ref>
+
<ref name="pmid:19228340">Kawakatsu, T; Taramino, G; Itoh, J; Allen, J; Sato, Y; Hong, SK; Yule, R; Nagasawa, N; Kojima, M; Kusaba, M; Sakakibara, H; Sakai, H; Nagato, Y. (2009) PLASTOCHRON3/GOLIATH encodes a glutamate carboxypeptidase required for proper development in rice.The Plant journal : for cell and molecular biology 58: 6.</ref>
<ref name="10608658">Ståhl, U; Lee, M; Sjödahl, S; Archer, D; Cellini, F; Ek, B; Iannacone, R; MacKenzie, D; Semeraro, L; Tramontano, E; Stymme, S. (1999) Plant low-molecular-weight phospholipase A2S (PLA2s) are structurally related to the animal secretory PLA2s and are present as a family of isoforms in rice (Oryza sativa).Plant molecular biology 41: 4.</ref>
+
<ref name="pmid:10608658">Ståhl, U; Lee, M; Sjödahl, S; Archer, D; Cellini, F; Ek, B; Iannacone, R; MacKenzie, D; Semeraro, L; Tramontano, E; Stymme, S. (1999) Plant low-molecular-weight phospholipase A2S (PLA2s) are structurally related to the animal secretory PLA2s and are present as a family of isoforms in rice (Oryza sativa).Plant molecular biology 41: 4.</ref>
 
</references>
 
</references>
  

Revision as of 06:22, 16 December 2013

Please input one-sentence summary here.

Annotated Information

Function

Taken together, our results indicated that the patatin-like PLA2 might play a significant role in the formation of vascular bundles, and that the dep3 mutant may provide another EP resource for rice breeding programsCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. Leafy head2, which encodes a putative RNA-binding protein, regulates shoot development of riceCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. Mutants with abnormal leaf developmental patterns not only provide a great insight into understanding the regulatory mechanism of plant architecture, but also enrich the ways to its modification by which crop yield could be improvedCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. We show that PLA2 normally acts to retard the rate of leaf maturation but does so independently of PLA1, which encodes a member of the P450 familyCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. It was unusually stable with regard to heat, acidity, and organic solvents but was sensitive to disulfide bond-reducing agentsCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. Phospholipase A(2)s (PLA(2)s) constitute a large superfamily of enzymes whose products are important for a multitude of signal transduction processes, lipid mediator release, lipid metabolism, development, plant stress responses, and host defenseCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. Instead, it produced a leafy panicle, in which all primary rachis-branches were converted to vegetative shootsCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. Architecture of the rice inflorescence, which is determined mainly by the morphology, number and length of primary and secondary inflorescence branches, is an important agronomical traitCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. These results indicate that both PLA1 and PLA2 act downstream of the GA signal transduction pathway to regulate leaf developmentCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. Comparison of genome-scale expression profiles between wild-type and lhd2 plants suggested that LHD2 may regulate rice shoot development through KNOX and hormone-related genesCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. Although the pattern of leaf initiation is a key element of plant shoot architecture, little is known about how the time interval between initiation events, termed plastochron, is regulatedCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. Fine mapping and candidate gene analysis of dense and erect panicle 3, DEP3, which confers high grain yield in rice (Oryza sativa L.)Cite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. Here, we present a detailed analysis of plastochron2 (pla2), a rice (Oryza sativa) mutant that exhibits shortened plastochron and precocious maturation of leaves during the vegetative phase and ectopic shoot formation during the reproductive phaseCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. During vegetative development, higher plants continuously form new leaves in regular spatial and temporal patternsCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. In a Dissociation (Ds) insertion rice population, we identified a mutant, compact shoot and leafy head 1 (csl1), which produced massive number of leaves (~70) during the vegetative phaseCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. PLA3/GO encodes a glutamate carboxypeptidase, which is thought to catabolize small acidic peptides and produce small signaling moleculesCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. CSL1 may represent a novel gene, which functions downstream of PLA1 and/or PLA2, or alternatively functions in a separate pathway, involved in the regulation of leaf initiation and developmental transition via plant hormones or other mobile signalsCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. Double mutant analysis revealed that PLA1, PLA2 and PLA3 are regulated independently but function redundantlyCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. Despite the importance of PLA genes in plant development, their molecular functions remain unknownCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. The mutant allele gene carried a 408 bp genomic deletion within LOC_Os06g46350, which included the last 47 bp coding region of the third exon and the first 361 bp of the 3'-untranslated regionCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. Based on these analyses, we propose a model in which plastochron is determined by signals from immature leaves that act non-cell-autonomously in the shoot apical meristem to inhibit the initiation of new leavesCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. preceded by a 25 amino acid signal peptide), and were derived from four expressed sequence tag (EST) clonesCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. Here we report the identification of the rice gene PLASTOCHRON3 (PLA3)/GOLIATH (GO) that regulates various developmental processes including the rate of leaf initiation (the plastochron)Cite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. csl1 is most likely a dominant mutation because no mutant segregant was observed in progeny of 67 siblings of the csl1 mutantCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. The crystal structure of rice (Oryza sativa) isoform 2 phospholipase A(2) has been determined to 2.0 A resolution using sulfur SAD phasing, and shows that the class XIb phospholipases have a unique structure compared with other secreted PLA(2)sCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. The C-terminal half is folded into three anti-parallel alpha-helices, of which the two first are also present in other secreted PLA(2)s and contain the conserved catalytic histidine and calcium liganding aspartate residuesCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. A 53-amino acid-long N-terminal sequence was determined and aligned with other sequences, giving 62% identity to the deduced amino acid sequence of some rice (Oryza sativa) expressed sequence tag clonesCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. We found that gibberellin (GA) is the major phytohormone that promotes PLA1 and PLA2 expressionCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. The full sequences of two distinct but homologous rice (Oryza sativa) cDNAs are given hereCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. This sequence was different from but homologous to the PLA2-I and PLA2-II sequencesCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. Phenotypically csl1 resembled pla mutants in short plastochron but was more severe in the conversion of the reproductive organs to vegetative organsCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. The N-terminal half of the chain contains mainly loop structure, including the conserved Ca(2+)-binding loop, but starts with a short 3(10)-helix and also includes two short anti-parallel beta-strandsCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. PLASTOCHRON3/GOLIATH encodes a glutamate carboxypeptidase required for proper development in riceCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. Recently, we purified to homogeneity and characterized a low-molecular-weight calcium-dependent phospholipase A2 (PLA2) from developing elm seed endospermCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. However, in contrast to pla1 and pla2, pla3 showed pleiotropic phenotypes including enlarged embryo, seed vivipary, defects in SAM maintenance and aberrant leaf morphologyCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. Purification and characterization of a low-molecular-weight phospholipase A2 from developing seeds of elmCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. Phospholipase A2 (PLA2) was purified about 180,000 times compared with the starting soluble-protein extract from developing elm (Ulmus glabra) seedsCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. They contained twelve conserved cysteine residues and sequences that are likely to represent the Ca(2+)-binding loop and active-site motif, which are characteristic of animal secretory PLA2sCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. The octanoate molecule in the complex structure is bound in a hydrophobic pocket, which extends to the likely membrane interface and is proposed to model the binding of the product fatty acidCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. On sodium dodecyl sulfate-polyacrylamide gel electrophoresis the purified fraction showed a single protein band with a mobility that corresponded to 15 kD, from which activity could be recoveredCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. Southern blot analysis suggested that multiple copies of such genes are likely to occur in the rice and in other plant genomesCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. Rice PLASTOCHRON genes regulate leaf maturation downstream of the gibberellin signal transduction pathwayCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. Rice PLASTOCHRON 1 (PLA1) and PLA2 genes regulate leaf maturation and plastochron, and their loss-of-function mutants exhibit small organs and rapid leaf emergenceCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. The dep3 mutation also regulated other panicle characteristics, including panicle length, grain shape and grain number per panicleCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. PLASTOCHRON2 regulates leaf initiation and maturation in riceCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. The shoot apical meristem (SAM) produces lateral organs in a regular spacing (phyllotaxy) and at a regular interval (phyllochron) during the vegetative phaseCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. These encode mature proteins of 1 19 amino acids (PLA2-I, preceded by a 19 amino acid signal peptide) and 128 amino acids (PLA2-IICite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. They encode a cytochrome P450 protein CYP78A11 and an RNA-binding protein, respectivelyCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. The DEP3 gene was identified as the candidate via a map-based cloning approach and was predicted to encode a patatin-like phospholipase A2 (PLA2) superfamily domain-containing proteinCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. The molecular and genetic analysis showed that LHD2 encodes a putative RNA binding protein with 67% similarity to maize TE1Cite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title. The corresponding PLA2 gene is revealed to be an orthologue of terminal ear1, a maize (Zea mays) gene that encodes a MEI2-like RNA binding proteinCite error: Invalid <ref> tag; name cannot be a simple integer. Use a descriptive title.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.
Cite error: <ref> tag defined in <references> has group attribute "" which does not appear in prior text.

Structured Information

Gene Name

Os01g0907900

Description

Similar to Terminal ear1

Version

NM_001051674.1 GI:115441718 GeneID:4324983

Length

3557 bp

Definition

Oryza sativa Japonica Group Os01g0907900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:41279485..41283041

Sequence Coding Region

41279485..41280220,41280332..41280500,41280573..41281076,41281207..41281335,41282437..41282578
,41282670..41283041

Expression

GEO Profiles:Os01g0907900

Genome Context

<gbrowseImage1> name=NC_008394:41279485..41283041 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:41279485..41283041 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggaggaaggaggtgggagtggcgtgggtgggatgcagggagcggcgtcgaatcttctggacgccggagctcaggcgttctaccctgccgtcggcgcgccgttcccgttccagcagcttccgcaccagctgtactgcccgcagccgccgccgccgccgtaccaggtcatgccggtgccgccgccgccgccgccggtgggcttgcctgtaccgccgctgccggcgacgatggcgccgcagccgggctactgcgtgccggcggccgcgacggtggtggacggtccggccagccgcgccgtcgtgctgagcctggtgccgccgcacgcgccggaggacgagatcgcccgcgcgatggctccgttcggtgcggtgcgcgccgtggacgcgtcggcggtggcgtccgagggcgtcgcgaccgtctacttcttcgatctccgctccgccgagcacgccgtcacgggggtccgcgagcagcacatccggcagcagtgccggctcggccagctctacgccgccgccgccgccgccgccgcctcgtccccgacctggcccccgccggcgtgggactggccccacgacgacaaccgcgggctcgtcctcggccaggccgtctgggcccacttcgccgccgcctccaccgtccccgacgacggcgccagccgcggctccctcgtcgtgctcaattccctccccgccatgtccgtgttcgaactccgcgaaatcttccaagcatacggtgacgtgaaggacgtgagggagtcggcgctgcggccgagcaacaagttcgtcgagttcttcgacacgcgcgacgccgaccgcgcgctccacgagctcaacggcaaggagctcttcggccgccgcctcgtcgtcgagtacacgcgcccttccctccccggcccacgcaggcgcgggcacgtgtcgcaccagcccttggccccgacgccgccgaggctgcaggcggcttggcggccggcgccggcgccgtcgcagtctgcgcagccgtcgtcgtctggctccggcaaggcgagggaaggcgtggtgcttctgcgcaggagctccgggaaaggtagctcgggtagccagtccaagggcggtggcaatgctggccacgagcggaagagcaagggcggcaagagcgccgcggcggcgtgttcgacggcggcttcagcatcgtcgtctaccgcaacggcgcccagcaagcaaagccagaaaggcggcggcggcggcggcggccgtggcgggagctggagaggccagaagagcgggtgggaggctcgcttcctgttcaaagaacccgaggccgcggccgccgccgccggcgacgctgccgcctccgagacgcatgagccggcgagctgcaaggacacgagaaccaccgtgatgatcaggaacatcccaaacaagtacagccagaagctgctgctcaacatgctggacaaccactgcatcctctccaaccagcagatcgaggcgagctgcgaagacgaagcccagccattctcctcctacgatttcctctacctccccatagatttcaacaacaagtgcaacgtgggctatggcttcgtcaacctcacctcgccggaggctgccgtgcggctgtacaaggcgttccacaagcaaccgtgggaggtgttcaactcgcgcaagatttgccaagtgacatacgcacgcgtgcaaggcctggacgcgctcaaggagcacttcaagaactccaagttcccgtgcgacagcgacgagtacctgcccgtggtgttctcgccgccgcgggacggcaagctgctcacggagccggtgccgctggtcggccgctcgccggcaccgtcgtcggcgtccggggcgtcgtcgccgcccaagagctgcgccgcgagcgtcgacccactcgcgcaggagctcatgacagcgccgtcttcctccggcgacggcgcctcctccgcctcctcgtccaatgcccacgccgacgaggatgacgtccatggcgaaaccggtggtgaccgtggcgacgacgcggggctcgatctggagctacagcgcctaggctacactgactag</cdnaseq>

Protein Sequence

<aaseq>MEEGGGSGVGGMQGAASNLLDAGAQAFYPAVGAPFPFQQLPHQL YCPQPPPPPYQVMPVPPPPPPVGLPVPPLPATMAPQPGYCVPAAATVVDGPASRAVVL SLVPPHAPEDEIARAMAPFGAVRAVDASAVASEGVATVYFFDLRSAEHAVTGVREQHI RQQCRLGQLYAAAAAAAASSPTWPPPAWDWPHDDNRGLVLGQAVWAHFAAASTVPDDG ASRGSLVVLNSLPAMSVFELREIFQAYGDVKDVRESALRPSNKFVEFFDTRDADRALH ELNGKELFGRRLVVEYTRPSLPGPRRRGHVSHQPLAPTPPRLQAAWRPAPAPSQSAQP SSSGSGKAREGVVLLRRSSGKGSSGSQSKGGGNAGHERKSKGGKSAAAACSTAASASS STATAPSKQSQKGGGGGGGRGGSWRGQKSGWEARFLFKEPEAAAAAAGDAAASETHEP ASCKDTRTTVMIRNIPNKYSQKLLLNMLDNHCILSNQQIEASCEDEAQPFSSYDFLYL PIDFNNKCNVGYGFVNLTSPEAAVRLYKAFHKQPWEVFNSRKICQVTYARVQGLDALK EHFKNSKFPCDSDEYLPVVFSPPRDGKLLTEPVPLVGRSPAPSSASGASSPPKSCAAS VDPLAQELMTAPSSSGDGASSASSSNAHADEDDVHGETGGDRGDDAGLDLELQRLGYT D</aaseq>

Gene Sequence

<dnaseqindica>1..736#848..1016#1089..1592#1723..1851#2953..3094#3186..3557#atggaggaaggaggtgggagtggcgtgggtgggatgcagggagcggcgtcgaatcttctggacgccggagctcaggcgttctaccctgccgtcggcgcgccgttcccgttccagcagcttccgcaccagctgtactgcccgcagccgccgccgccgccgtaccaggtcatgccggtgccgccgccgccgccgccggtgggcttgcctgtaccgccgctgccggcgacgatggcgccgcagccgggctactgcgtgccggcggccgcgacggtggtggacggtccggccagccgcgccgtcgtgctgagcctggtgccgccgcacgcgccggaggacgagatcgcccgcgcgatggctccgttcggtgcggtgcgcgccgtggacgcgtcggcggtggcgtccgagggcgtcgcgaccgtctacttcttcgatctccgctccgccgagcacgccgtcacgggggtccgcgagcagcacatccggcagcagtgccggctcggccagctctacgccgccgccgccgccgccgccgcctcgtccccgacctggcccccgccggcgtgggactggccccacgacgacaaccgcgggctcgtcctcggccaggccgtctgggcccacttcgccgccgcctccaccgtccccgacgacggcgccagccgcggctccctcgtcgtgctcaattccctccccgccatgtccgtgttcgaactccgcgaaatcttccaagcatacggtacatacaccaccaccgcacgctttcttccgcgaattcctccatgtttcgcttcttgtgtttccaaccaattcattctcttggtcgggtcgcctcgtcgtgtgtttgcaggtgacgtgaaggacgtgagggagtcggcgctgcggccgagcaacaagttcgtcgagttcttcgacacgcgcgacgccgaccgcgcgctccacgagctcaacggcaaggagctcttcggccgccgcctcgtcgtcgagtacacgcgcccttccctccccggcccacgcaggtaaaagaattcaccgtcgtgttaattcccatcgaaaacgcacggtaaaactaatttggctgtggttggcaggcgcgggcacgtgtcgcaccagcccttggccccgacgccgccgaggctgcaggcggcttggcggccggcgccggcgccgtcgcagtctgcgcagccgtcgtcgtctggctccggcaaggcgagggaaggcgtggtgcttctgcgcaggagctccgggaaaggtagctcgggtagccagtccaagggcggtggcaatgctggccacgagcggaagagcaagggcggcaagagcgccgcggcggcgtgttcgacggcggcttcagcatcgtcgtctaccgcaacggcgcccagcaagcaaagccagaaaggcggcggcggcggcggcggccgtggcgggagctggagaggccagaagagcgggtgggaggctcgcttcctgttcaaagaacccgaggccgcggccgccgccgccggcgacgctgccgcctccgagacgcatgagccggcgagctgcaaggacacgagaaccaccgtgatgatcaggaacatcccaaacaagtacaggtcactccgctagcttccacgttgttgacgaaatgctatatttcatgggcgccgcgagcccagaattgcctgcctcgcattgcgagcttggcactgatgcctgagcttgtcgtctgttgcttgttcgcagccagaagctgctgctcaacatgctggacaaccactgcatcctctccaaccagcagatcgaggcgagctgcgaagacgaagcccagccattctcctcctacgatttcctctacctccccatagatttcaagtgagtcagctcccgatatgctgtatttatattttatggtgcccaatgcaagaacactgcggcacacactgtccacgcccaatgacaatgacggcctccatgcttcatttccgactgagaattcagtcctagaaaactaattaattttatgattcttgaggggaattgtgcaatggaattgcattgccgtgtgaaggaaggacaaaggtatatgaaaggggcttggaaatgtactgggagatgaatgggtagttgggagctctagctgctggtagtgatgtgtgagcttgtggatcgagttatctttgggctgggtagtactagcatgttactgcactgtactgctagtctgcaacacatatggacgcctactctggtgccatggctgtaatagcccaaatggaaaggaaattggcagtccaagggagatcacaccagatccttctcgttttgatgcatcaaatccttttgttgcatgcaatcctctgatcatgagcatctgttcacatgtctacctttcttgcgcacctgcctctaggatctcctgcctgccttgctctctttcttgcttgcttgcgctgtcttgacctgcacttccatagcaaagtccaacgcaaaaaggaggggctagacgtcatggagtagcggtgaaaaggtgcatcaatgcaaaagcgttttcaattttgacatgtagtaatatatttcttttcctgagaaaaaggtatggtgaccaatgcataattaagcactttcttttcactggagtaccaacttttatctttgcacgaaccaagttgagaaaagacctatcaaatgccccaatgactagcgtgcattgtggaatcaaaaggtagctccacaacaaaaatatgatagaaatattgttgtgcaagtttatagttccccgagcttctgacttcgaaggcctcaattccaagaatatttgtgttcttgaccttgacaagtcgtttgttatcattcataactcatttttggtcacccggttctttatcgcttctctacttgttgagaagtttttaaattcaggcattaaattatcttttcggctgtgctaacctgctaaaatatgaggccatgcagcaacaagtgcaacgtgggctatggcttcgtcaacctcacctcgccggaggctgccgtgcggctgtacaaggcgttccacaagcaaccgtgggaggtgttcaactcgcgcaagatttgccaagtgacatacgcacgcgtgcaagtacgagcgccgttaaatctctcccaattgtgctgataaatctagaccgatcatcatgtgtggcaagtgctaaacccgtgcatgcgcgcagggcctggacgcgctcaaggagcacttcaagaactccaagttcccgtgcgacagcgacgagtacctgcccgtggtgttctcgccgccgcgggacggcaagctgctcacggagccggtgccgctggtcggccgctcgccggcaccgtcgtcggcgtccggggcgtcgtcgccgcccaagagctgcgccgcgagcgtcgacccactcgcgcaggagctcatgacagcgccgtcttcctccggcgacggcgcctcctccgcctcctcgtccaatgcccacgccgacgaggatgacgtccatggcgaaaccggtggtgaccgtggcgacgacgcggggctcgatctggagctacagcgcctaggctacactgactag</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0907900, RefSeq:Os01g0907900