Difference between revisions of "Os02g0650300"
(→References) |
(→Function) |
||
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | |||
| − | |||
Our results suggest that OsYSL16 plays a role in the allocation of iron(III)-deoxymugineic acid via the vascular bundles<ref name="pmid:22644443"/>. | Our results suggest that OsYSL16 plays a role in the allocation of iron(III)-deoxymugineic acid via the vascular bundles<ref name="pmid:22644443"/>. | ||
| Line 31: | Line 29: | ||
Proximal regions of IDEF1-regulated gene promoters also showed enrichment of RY elements (CATGCA), which regulate gene expression during seed maturation<ref name="pmid:19737364"/>. | Proximal regions of IDEF1-regulated gene promoters also showed enrichment of RY elements (CATGCA), which regulate gene expression during seed maturation<ref name="pmid:19737364"/>. | ||
| − | |||
===Expression=== | ===Expression=== | ||
Revision as of 03:20, 21 December 2013
Please input one-sentence summary here.
Contents
Annotated Information
Function
Our results suggest that OsYSL16 plays a role in the allocation of iron(III)-deoxymugineic acid via the vascular bundles[1].
In the vascular bundles of unelongated nodes, it was detected in the xylem of old leaves and the phloem of new leaves[1].
These results strongly suggest that OsYSL15 is the dominant iron(III)-deoxymugineic acid transporter responsible for iron uptake from the rhizosphere and is also responsible for phloem transport of iron[2].
The expression of several genes encoding late embryogenesis abundant proteins, including Osem, was induced in Fe-deficient roots and/or leaves in an IDEF1-dependent manner, suggesting a possible function of seed maturation-related genes in Fe-deficient vegetative organs[3].
Expression of the OsYSL16 promoter fused to the β-glucuronidase gene showed that OsYSL16 is expressed in the root epidermis and vascular bundles of whole plants[1].
Graminaceous plants take up iron through YS1 (yellow stripe 1) and YS1-like (YSL) transporters using iron-chelating compounds known as mugineic acid family phytosiderophores[2].
OsYSL16 plays a role in the allocation of iron[1].
Graminaceous plants acquire iron by secreting mugineic acid family phytosiderophores into the rhizosphere and taking up complexes of iron and phytosiderophores through YSL (yellow stripe 1-like) transporters[1].
Rice OsYSL15 is a transporter of the iron(III)-2'-deoxymugineic acid complex[1].
Rice OsYSL15 is an iron-regulated iron(III)-deoxymugineic acid transporter expressed in the roots and is essential for iron uptake in early growth of the seedlings[2].
Furthermore, OsYSL16-knockdown plants accumulated more iron in the vascular bundles of the leaves[1].
The rice transcription factor IDEF1 is essential for the early response to iron deficiency, and induces vegetative expression of late embryogenesis abundant genes[3].
Proximal regions of IDEF1-regulated gene promoters also showed enrichment of RY elements (CATGCA), which regulate gene expression during seed maturation[3].
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 Kakei, Y; Ishimaru, Y; Kobayashi, T; Yamakawa, T; Nakanishi, H; Nishizawa, NK. (2012) OsYSL16 plays a role in the allocation of iron.Plant molecular biology 79: 6.
- ↑ 2.0 2.1 2.2 Inoue, H; Kobayashi, T; Nozoye, T; Takahashi, M; Kakei, Y; Suzuki, K; Nakazono, M; Nakanishi, H; Mori, S; Nishizawa, NK. (2009) Rice OsYSL15 is an iron-regulated iron(III)-deoxymugineic acid transporter expressed in the roots and is essential for iron uptake in early growth of the seedlings.The Journal of biological chemistry 284: 6.
- ↑ 3.0 3.1 3.2 Kobayashi, T; Itai, RN; Ogo, Y; Kakei, Y; Nakanishi, H; Takahashi, M; Nishizawa, NK. (2009) The rice transcription factor IDEF1 is essential for the early response to iron deficiency, and induces vegetative expression of late embryogenesis abundant genes.The Plant journal : for cell and molecular biology 60: 6.
Structured Information
| Gene Name |
Os02g0650300 |
|---|---|
| Description |
Oligopeptide transporter OPT superfamily protein |
| Version |
NM_001186167.1 GI:297721466 GeneID:9268232 |
| Length |
1969 bp |
| Definition |
Oryza sativa Japonica Group Os02g0650300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 2:27086997..27088965 |
| Sequence Coding Region |
27088433..27088646,27088748..27088911 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008395:27086997..27088965 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008395:27086997..27088965 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>actaattctgcaatctgcattcatgacagattgcaactccatgggtttctaaaatattttgggcttagcttattttggagcttcttccaatggttctacacgggaggcaatgcctgtggatttgttcagttccctacttttggtctgaaagcctggaaacaatcattcttctttgattttagcctcacatatgttggtgcggggatgatttgctcacaccttgtgaacctctctaccctccttggtgcggtcatttcatggggaataatgtggccacttatcagcaaacataagggggactggtaccctgcaaacatacctgaaagcagcatgacaagtttgtatggttacaaggtctcatattttctcaatgcttaa</cdnaseq> |
| Protein Sequence |
<aaseq>TNSAICIHDRLQLHGFLKYFGLSLFWSFFQWFYTGGNACGFVQF PTFGLKAWKQSFFFDFSLTYVGAGMICSHLVNLSTLLGAVISWGIMWPLISKHKGDWY PANIPESSMTSLYGYKVSYFLNA</aaseq> |
| Gene Sequence |
<dnaseqindica>320..533#55..218#aattaattgtgctcattgcattattcttgttagacagtcgttgaccctaaatgaactaattctgcaatctgcattcatgacagattgcaactccatgggtttctaaaatattttgggcttagcttattttggagcttcttccaatggttctacacgggaggcaatgcctgtggatttgttcagttccctacttttggtctgaaagcctggaaacaatcgtaagaattatatgctaatttcctaattgttcatcacagatttatataaattgtagcatgcggtgacaaattttctaagtctgaatttgtttggatatcagattcttctttgattttagcctcacatatgttggtgcggggatgatttgctcacaccttgtgaacctctctaccctccttggtgcggtcatttcatggggaataatgtggccacttatcagcaaacataagggggactggtaccctgcaaacatacctgaaagcagcatgacaagtttgtatggttacaaggtctcatattttctcaatgcttaatgtaaaagcagatactacttacaaaaccatcagataacttatgtaaattgctccttttgcagtcgtttttatgcattgctctgattatgggggatggcctgtaccattttgttaaagttaccggtgtcactgctaagagtttacataatagatttaaccgaaaaagtgttagcaacacaggtgagaaaatgaaaccattgcaaattcaactacatggaaatggaatgcctctcacactcttccatcaccttaattttcacatactcataacactgttaatgatggctaaatgaaatgaattgcagcatcagaggagggtgatatggtttcattagatgatctacaacgtgatgaggtattcaagaggggtactgtcccttcttggatggcatacagtggttacttcttgctaagcatcattgcggtaatcaccataccgataatgtttcgacaagtgaagtggtactacgtgatcatagcctacgcgctcggcccggtgctaggattcgccaattcctacggagcagggctcacggacatcaacatggggtacaactacggcaagatcgctctcttcgtctttgcagcttgggctggcaaggacaatggcgtcatagccggccttgtggttggcaccctggtgaagcagctggtgctcgtctctgccgatctgatgcacgatctcaagacgggacatctcaccttgacatcgccgaggtccatgctcgtgggagagctcatcgggacaggcattggctgcttcatcgcgccactgacgttcatgctgttctacagggcgtttgacatcgggaaccccgatggctactggaaggcgccatacgcgctgatctaccgcaacatggcgatcctcgggatcgagggcatctcggcgctgcccaagcactgcctctcgctctccgtcgggttcttcgcgttcgccgtgctcacgaacgtggcgagggacgccctgccggcgaggtacaagaagctcgtgccgctgccgacggcgatggccgtgccgttcctcgtaggggcgagcttcgccatcgacatgtgcgtcgggagcctggtgctgtttgcttggaacaagatgaacaagaaggaggctgccttcatggtgcctgctgttgcgtctgggctcatgtgtggcgatggcatttggaccttcccttcttctatccttgctctcgctaagattaagccaccgatctgcatgaagtttacgcctggaagctaagaggtgtagtgtgtttaatttcatgggtggaggattgcagaaataaacagtgatgattaactgtaaatgtgtcttttggttgtagtgagctgctgtttgcctatgatccaagtcatgtttgtgttttaatttacctatcgaattagctgtgtttgtacacttgtacattttataacttgagaattgtttagtttggcat</dnaseqindica> |
| External Link(s) |
