Difference between revisions of "Os09g0363900"
(→References) |
|||
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | Os09g0363900,also called "ONI3(or ONION3)",which is required for avoiding organ fusions in rice.Loss of function mutations of ONI3 showed abnormal organ fusions in developing shoots. The mutant seedlings showed fusions between neighboring organs and also within an organ; they stopped growing soon after germination and subsequently died. ONI3 encode an enzyme that is most similar to Arabidopsis HOTHEAD.<ref | + | Os09g0363900,also called "ONI3(or ONION3)",which is required for avoiding organ fusions in rice.Loss of function mutations of ONI3 showed abnormal organ fusions in developing shoots. The mutant seedlings showed fusions between neighboring organs and also within an organ; they stopped growing soon after germination and subsequently died. ONI3 encode an enzyme that is most similar to Arabidopsis HOTHEAD.<ref>1</ref> |
===Expression=== | ===Expression=== | ||
| − | ONI3 was expressed in shoots and developing embryos but not in leaves, roots or calli. To be more specific, ONI3 was expressed in the outermost cell layer of the SAM, young leaf and floral organs.In the embryo 7 days after pollination (DAP), ONI3 expression was detected in shoot organs such as the SAM,leaves and coleoptile. In the vegetative growth phase, at 1 month after germination, ONI3 expression was detected specifically in the outermost cell layer of the SAM and young leaves. In the reproductive growth phase, ONI3 expression was detected again in the outermost cell layer of developing floral organs. In the ovary, ONI3 expression was detected in the outermost cell layer of the ovary and ovule. Integuments also showed the expression. No signal was detected in the inner cells of any organs or at any developmental stages examined. These expression analyses revealed that ONI3 is an outermost cell layer-specific gene of the SAM and young above-ground organs throughout the life cycle.<ref | + | ONI3 was expressed in shoots and developing embryos but not in leaves, roots or calli. To be more specific, ONI3 was expressed in the outermost cell layer of the SAM, young leaf and floral organs.In the embryo 7 days after pollination (DAP), ONI3 expression was detected in shoot organs such as the SAM,leaves and coleoptile. In the vegetative growth phase, at 1 month after germination, ONI3 expression was detected specifically in the outermost cell layer of the SAM and young leaves. In the reproductive growth phase, ONI3 expression was detected again in the outermost cell layer of developing floral organs. In the ovary, ONI3 expression was detected in the outermost cell layer of the ovary and ovule. Integuments also showed the expression. No signal was detected in the inner cells of any organs or at any developmental stages examined. These expression analyses revealed that ONI3 is an outermost cell layer-specific gene of the SAM and young above-ground organs throughout the life cycle.<ref>1</ref><ref>2</ref> |
===Evolution=== | ===Evolution=== | ||
ONI3 encodes a protein similar to Arabidopsis HTH. HTH encodes an enzyme similar to long-chain fatty acid (LCFA) o-alcohol dehydrogenases, and was shown to be involved in biosynthesis of long-chain a-, o-dicarboxylic fatty acids. Since ONI3 and HTH showed high sequence identity (56% identity in | ONI3 encodes a protein similar to Arabidopsis HTH. HTH encodes an enzyme similar to long-chain fatty acid (LCFA) o-alcohol dehydrogenases, and was shown to be involved in biosynthesis of long-chain a-, o-dicarboxylic fatty acids. Since ONI3 and HTH showed high sequence identity (56% identity in | ||
| − | their entire amino acid sequences) and was categorized into the same clade in a phylogenetic tree, ONI3 also seemed to encode LCFA o-alcohol dehydrogenase and plays a role in biosynthesis of long-chain a-, o-dicarboxylic fatty acids, but this remains to be characterized biochemically. | + | their entire amino acid sequences) and was categorized into the same clade in a phylogenetic tree, ONI3 also seemed to encode LCFA o-alcohol dehydrogenase and plays a role in biosynthesis of long-chain a-, o-dicarboxylic fatty acids, but this remains to be characterized biochemically. |
| − | A database search identified six homologs of ONI3 in the rice genome. Among them, Os08g0401500 was most similar to ONI3, and was categorized into the same clade that includes HTH. The amino acid sequences of ONI3 and Os08g0401500 were 72% identical to each other. ONI3 showed 32–50% amino acid identities with the remaining five homologs.<ref | + | A database search identified six homologs of ONI3 in the rice genome. Among them, Os08g0401500 was most similar to ONI3, and was categorized into the same clade that includes HTH. The amino acid sequences of ONI3 and Os08g0401500 were 72% identical to each other. ONI3 showed 32–50% amino acid identities with the remaining five homologs.<ref>1</ref><ref>3</ref> |
| Line 22: | Line 22: | ||
==References== | ==References== | ||
| − | + | <references /> | |
| − | + | Akiba T, Hibara K, Kimura F, Tsuda K, Shibata K, Ishibashi M, Moriya C, Nakagawa K, Kurata N, Itoh J, Ito Y. (2014) Organ fusion and defective shoot development in oni3 mutants of rice.Plant Cell Physiol. 55(1): 42–51 | |
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | |||
| − | + | Fujita, M., Horiuchi, Y., Ueda, Y., Mizuta, Y., Kubo, T., Yano, K. et al.(2010) Rice expression atlas in reproductive development. Plant Cell Physiol. 51: 2060–2081. | |
| − | |||
| − | + | Kurdyukov, S., Faust, A., Trenkamp, S., Bar, S., Franke, R., Efremova, N. et al. (2006) Genetic and biochemical evidence for involvement of HOTHEAD in the biosynthesis of long-chain a-, o-dicarboxylic fatty acids and formation of extracellular matrix. Planta 224: 315–329. | |
| − | |||
| − | |||
| − | |||
| − | |||
==Structured Information== | ==Structured Information== | ||
Revision as of 17:11, 7 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Os09g0363900,also called "ONI3(or ONION3)",which is required for avoiding organ fusions in rice.Loss of function mutations of ONI3 showed abnormal organ fusions in developing shoots. The mutant seedlings showed fusions between neighboring organs and also within an organ; they stopped growing soon after germination and subsequently died. ONI3 encode an enzyme that is most similar to Arabidopsis HOTHEAD.[1]
Expression
ONI3 was expressed in shoots and developing embryos but not in leaves, roots or calli. To be more specific, ONI3 was expressed in the outermost cell layer of the SAM, young leaf and floral organs.In the embryo 7 days after pollination (DAP), ONI3 expression was detected in shoot organs such as the SAM,leaves and coleoptile. In the vegetative growth phase, at 1 month after germination, ONI3 expression was detected specifically in the outermost cell layer of the SAM and young leaves. In the reproductive growth phase, ONI3 expression was detected again in the outermost cell layer of developing floral organs. In the ovary, ONI3 expression was detected in the outermost cell layer of the ovary and ovule. Integuments also showed the expression. No signal was detected in the inner cells of any organs or at any developmental stages examined. These expression analyses revealed that ONI3 is an outermost cell layer-specific gene of the SAM and young above-ground organs throughout the life cycle.[2][3]
Evolution
ONI3 encodes a protein similar to Arabidopsis HTH. HTH encodes an enzyme similar to long-chain fatty acid (LCFA) o-alcohol dehydrogenases, and was shown to be involved in biosynthesis of long-chain a-, o-dicarboxylic fatty acids. Since ONI3 and HTH showed high sequence identity (56% identity in their entire amino acid sequences) and was categorized into the same clade in a phylogenetic tree, ONI3 also seemed to encode LCFA o-alcohol dehydrogenase and plays a role in biosynthesis of long-chain a-, o-dicarboxylic fatty acids, but this remains to be characterized biochemically.
A database search identified six homologs of ONI3 in the rice genome. Among them, Os08g0401500 was most similar to ONI3, and was categorized into the same clade that includes HTH. The amino acid sequences of ONI3 and Os08g0401500 were 72% identical to each other. ONI3 showed 32–50% amino acid identities with the remaining five homologs.[4][5]
You can also add sub-section(s) at will.
Labs working on this gene
Graduate School of Agricultural Science, Tohoku University, Sendai, 981-8555 Japan
References
Akiba T, Hibara K, Kimura F, Tsuda K, Shibata K, Ishibashi M, Moriya C, Nakagawa K, Kurata N, Itoh J, Ito Y. (2014) Organ fusion and defective shoot development in oni3 mutants of rice.Plant Cell Physiol. 55(1): 42–51
Fujita, M., Horiuchi, Y., Ueda, Y., Mizuta, Y., Kubo, T., Yano, K. et al.(2010) Rice expression atlas in reproductive development. Plant Cell Physiol. 51: 2060–2081.
Kurdyukov, S., Faust, A., Trenkamp, S., Bar, S., Franke, R., Efremova, N. et al. (2006) Genetic and biochemical evidence for involvement of HOTHEAD in the biosynthesis of long-chain a-, o-dicarboxylic fatty acids and formation of extracellular matrix. Planta 224: 315–329.
Structured Information
| Gene Name |
Os09g0363900 |
|---|---|
| Description |
Similar to HOTHEAD protein precursor (ADHESION OF CALYX EDGES protein) |
| Version |
NM_001069531.1 GI:115478804 GeneID:4346864 |
| Length |
5043 bp |
| Definition |
Oryza sativa Japonica Group Os09g0363900, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 9:12525599..12530641 |
| Sequence Coding Region |
12525764..12525818,12525923..12526494,12526947..12527335,12527480..12527793,12529490..12529844 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008402:12525599..12530641 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008402:12525599..12530641 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggctttgagcaagagaatgctattcatcttccaggccatggtttgcctctgctccttcagtttatcccaaggcaaccagcaattcagcttaaggaatctccctaccctccagaaggcgagcagcttcccagcgatgcgccacgagacatacgactacattgtcgtcggcgggggcaccgccggttgccccctggcggcgacattgtcgctcaagtacaaggtgctcctgctggagaggggagggtctccgtatggcaaccgcaacgtctcctacatggagaacttccacattggcctgagcaatatggcgccggactcggcgtctcaggccttcatctccactgacggcgtcatcaatgcccgagcgagggtgttgggaggtggcacctgcatcaatgccggcttctacagccgggccagctcaaacttcatccaggaggtaggctgggatgaagacctggtgaatgagtccttcccttgggtggaggacaagatcgtccagtggcctaagatcgcaccttggcaggctgcactaagggatgggctactccaagcaggtgtatctcctttcaatggctacacatatgaccatgtttctgggaccaaagttggtggcaccatctttgatgagactggctaccgccacacagcagccgacttacttgcagctggagaccctaacaacctaagggtgctgcttcatgctagtgtgaacaggatagtctttaactcgcagagagggcaactgaagccaagagcaaccggagttcagttcaccgatgagaatggaggactccaccaggcattcctcaacagcaactgtgatagtgaaatcattgtctctgctggcgcaattggcagcccccagctgctattgctcagtgggattggacccaagaatgaccttaggagccataaaattcctgtagttctccataacaagtatgtgggtaaagggatggctgataaccccatgaactccatattcataccgacgaaaagcccccctcgccagtccctgattgagactgttggaataactgaagctggtgtgttcattgaggccagtagtggttttggccagtcaccagaaagcatccattgccaccatggaatcatgtccgctgagattggacagctgtccacaattcctccgaaggaaagaagcctggaaaaagcacagaagtatgcaaataccaaacttaatctacccaaagagatattccatggtggttttatcctcgagaagattgatggtccactgtctacgggacatcttgccctgatagacactgatgtcaagaagaaccctgcggttaccttcaactacttcagtcatccacaggatctcactcgttgcgtctatggtatcaagaccattgaacgaatactgaagacaaaccgtttctctgaactgtctgccaacactgatggacattcaatggaaagagtgctcaatatgagtgtgcaggctaatgtgaacttgatacccaagcatacaaatgacacagaatccctagagcaattttgcagggatacagtaataaccatctggcactaccatggtggatgccatgtagggaaggtggttgatcagcaacaccgtgtgcttggagtttcaggcgtccgtgtagtcgatggctcaacattttctagatcaccagggacgaaccctcaagccacggtcatgatgatgggcagatattttggagtgatgatcctaaggggaagactaggtcgagcagctggagtgtaa</cdnaseq> |
| Protein Sequence |
<aaseq>MALSKRMLFIFQAMVCLCSFSLSQGNQQFSLRNLPTLQKASSFP AMRHETYDYIVVGGGTAGCPLAATLSLKYKVLLLERGGSPYGNRNVSYMENFHIGLSN MAPDSASQAFISTDGVINARARVLGGGTCINAGFYSRASSNFIQEVGWDEDLVNESFP WVEDKIVQWPKIAPWQAALRDGLLQAGVSPFNGYTYDHVSGTKVGGTIFDETGYRHTA ADLLAAGDPNNLRVLLHASVNRIVFNSQRGQLKPRATGVQFTDENGGLHQAFLNSNCD SEIIVSAGAIGSPQLLLLSGIGPKNDLRSHKIPVVLHNKYVGKGMADNPMNSIFIPTK SPPRQSLIETVGITEAGVFIEASSGFGQSPESIHCHHGIMSAEIGQLSTIPPKERSLE KAQKYANTKLNLPKEIFHGGFILEKIDGPLSTGHLALIDTDVKKNPAVTFNYFSHPQD LTRCVYGIKTIERILKTNRFSELSANTDGHSMERVLNMSVQANVNLIPKHTNDTESLE QFCRDTVITIWHYHGGCHVGKVVDQQHRVLGVSGVRVVDGSTFSRSPGTNPQATVMMM GRYFGVMILRGRLGRAAGV</aaseq> |
| Gene Sequence |
<dnaseqindica>4824..4878#4148..4719#3307..3695#2849..3162#798..1152#104..176#aggaaacaggggagggagagaggttttgccaccgttgttttggagggaaggaaaatcctaagaaggggaaagagtttagcttggcaggtggttctcaggctcaatggctttgagcaagagaatgctattcatcttccaggccatggtttgcctctgctccttcagtttatcccaaggtgcgcatctcttgtggttctgtctcatctcatgtttctcaggcattcctcctctattctgtattctgtctcatctcatgtttctcaggcattcctcctttattctgtacatttctgttccaccttcccattgaagaacttgcaatggtgaaatgcagttatatatgctagtttttgcttagcttctttctcgcaagaatatcattatcacgtgcacttccattatctgacactttggttcctatcattgtttatcgccacattggcctcaccactagtatttgagagtagcagaacatctaatcattcagagttcaatatttagagattgaaggataggaaataaatagtcaacacaatgccacaagacgtacctctcatccagtcctaggaggtacaatgccaactgccaagaggtccagaccctagtaatcatagcatcaattagattgatacactcatttatcaacatgcaaaaacaggttatgtttttagataatgaaagcttttattgaagtcatgcaaaaaaaaaaagggggttatagcatgagaaacttacagcagaacaaagcaaaactttttcaggcaatgacaacattatggaacactttgttttctcaggcaaccagcaattcagcttaaggaatctccctaccctccagaaggcgagcagcttcccagcgatgcgccacgagacatacgactacattgtcgtcggcgggggcaccgccggttgccccctggcggcgacattgtcgctcaagtacaaggtgctcctgctggagaggggagggtctccgtatggcaaccgcaacgtctcctacatggagaacttccacattggcctgagcaatatggcgccggactcggcgtctcaggccttcatctccactgacggcgtcatcaatgcccgagcgagggtgttgggaggtggcacctgcatcaatgccggcttctacagccgggccagctcaaagtaagcaattgcattgcacagatatggatgctatcttgtgtatcagtattcttacctgattatgattgttctcttccgtctacgagtgaccagccaagagagttcacagttcacacatgcaaatttaaccttttttttactgccgaagtgcagaatggtcagcattaatatatacacacaaacatatgcaagagaattcacagttcacacatgcaaatttaacctttttttttactgccgaagtgcagaatggtctcaatcatgatcaagacttcagatataatttactattatattctttaccataagagggcaagcacaaatagcagagcctaaaatgaagttagcataagtagattaaatataccaagtagtctctcagtatatgcaacacatggcctatcactttcacatgaacaaacatcagctctagggtaaatgcagagcagtgatagtgccagtagaaattactaatggtaactggtaagatctgcttgactgctgccaccctagcatactgcagccacctttgttcacccttcaagtggagtaatagctgtctgctgaaacgtgcagcagaacactaaatattattcactgttctcaatagtagcattcaattaccatgaaaccaaagtttctgccaattaggattctctggctacaacctcttgtttcttttctccagcgtccaaatggaaaagggaaaacggggaaacaaacaaacactaattagtgtagctcaaataggttctaatcgactaaaatgagccagccaaaagacacaaatgcataaaaccaccacctgcattactagcactcactctagaacgtacccagcactgcatttggacatgattatcggttcactaggactacatattttggttggtatgattctagacttctagtttatggttatcaaaatgcaggctttctttgagatttatcacaatgcagctctgcaatatataacgaaataaaatccagctgtaaaattagcaaaggttgtactttgagtgcttgcatacaaatgagcactagtgagaaagttgataacataaagaaaataagcagattgcaaaagtggtttgcattaaagtgcttcagtctggtattgcaaataattaactacgctggcagcagcacatgctgtggttttctcagtgaataaaaagacttccttgctcttcttgcagtcatgaactacatgttactgaaacagactagattgaaaagagacattgatgaaaaaaaaaaagagagagacaacaaaacaaaatcacatggggctataattgtttctttgcagtcatggtaactaagttgtctaggcaaaggacactaaataactaaaaccctagtagactcgaggctacttcaagtttgggccaattagtacatatgcattcgaattatttgtacagaatcgaattacaataggtcaatgggtgggccccacacacccgtgctcatcagtcatccctagtgatatacctgctcattaccagaaacgccaatgtgacttaaaaggtatcaataattgataagcttaatcccgtagtcttcaagaaggaattttacttctatattgatattcatattggtgaactacatgttaaattgttattggtgaactacatgttaaattgctaataacttgtataccatgtgtttttgttcttgaaacaaacagcttcatccaggaggtaggctgggatgaagacctggtgaatgagtccttcccttgggtggaggacaagatcgtccagtggcctaagatcgcaccttggcaggctgcactaagggatgggctactccaagcaggtgtatctcctttcaatggctacacatatgaccatgtttctgggaccaaagttggtggcaccatctttgatgagactggctaccgccacacagcagccgacttacttgcagctggagaccctaacaacctaagggtgctgcttcatgctagtgtgaacaggatagtctttaactcgcagagaggtaaataattacacatgtgtggccaaagctcctacaagttgtattatcttctaaaatagagttatatagaattatatgccatgaatagaaagagtaagttcagtaatcacgtaccatatttcagatacaccatttctgatgcagggcaactgaagccaagagcaaccggagttcagttcaccgatgagaatggaggactccaccaggcattcctcaacagcaactgtgatagtgaaatcattgtctctgctggcgcaattggcagcccccagctgctattgctcagtgggattggacccaagaatgaccttaggagccataaaattcctgtagttctccataacaagtatgtgggtaaagggatggctgataaccccatgaactccatattcataccgacgaaaagcccccctcgccagtccctgattgagactgttggaataactgaagctggtgtgttcattgaggccagtagtggttttggccagtcaccagaaagcatccattgccaccatggaatcatgtccgctgaggtatgtcatcaatcttacttgcatcatgagaagctttttgtgcataaaataggtctaaagcagtatcacaaacatcaggaaaaagctgctgcttagatctgcagacttcaaaaaggaaaacagattctaaagtctaaactatcaaaactcacattttgcaacattgcaaacacaacttagaccaattcattaattacaggtgaatatgcatatgcatataatagtatattctaagaaataatacttatctgatttataagtcattgttttatgcttagattttctaggaatcagatctcagaattgaacttcttgtcttggagattaaaaaaaataagtgttgtctacattgcaacaactccaataactgccatcatagtttccattgttgtctcaatttgttccctacttggccttgttggtctaatacatattatattcctatggtacagattggacagctgtccacaattcctccgaaggaaagaagcctggaaaaagcacagaagtatgcaaataccaaacttaatctacccaaagagatattccatggtggttttatcctcgagaagattgatggtccactgtctacgggacatcttgccctgatagacactgatgtcaagaagaaccctgcggttaccttcaactacttcagtcatccacaggatctcactcgttgcgtctatggtatcaagaccattgaacgaatactgaagacaaaccgtttctctgaactgtctgccaacactgatggacattcaatggaaagagtgctcaatatgagtgtgcaggctaatgtgaacttgatacccaagcatacaaatgacacagaatccctagagcaattttgcagggatacagtaataaccatctggcactaccatggtggatgccatgtagggaaggtggttgatcagcaacaccgtgtgcttggagtttcaggcgtccgtgtagtcgatggctcaacattttctagatcaccagggacgaaccctcaagccacggtcatgatgatgggcaggtacataaacacagtaaaaaattaacttctttagtctttacctaatgatattctaactttaaactcttaaagactaaattgcttccctcatatttcatactcagatattttggagtgatgatcctaaggggaagactaggtcgagcagctggagtgtaatcgattcctggacaccagccttttgttatgtgtgacctagagaagaaaaattactaattattgctgggatctagtgtgattcaccgaagaaagacaagctaggagtttcatctgtacccagtaatcatttgtgtcatgtgatattgcagatcaaatggtttattg</dnaseqindica> |
| External Link(s) |