Difference between revisions of "Os06g0157700"
(→Annotated Information) |
(→Evolution) |
||
| Line 12: | Line 12: | ||
Please input evolution information here. | Please input evolution information here. | ||
A previous study revealed that the Kasalath allele of Hd3a promotes heading under short-day conditions. The rice Heading date 1 (Hd1) gene, a homolog of CONSTANS (CO), has been shown to promote heading under short-day conditions. Besides, the amount of Hd3a mRNA is up-regulated by Hd1 under short-day conditions, suggesting that Hd3a promotes heading under the control of Hd1. These results indicate that Hd3a encodes a protein closely related to Arabidopsis FT and that the function and regulatory relationship with Hd1 and CO, respectively. Furthermore, Hd3a and FT are conserved between rice and Arabidopsis. (Kojima et al., 2002) | A previous study revealed that the Kasalath allele of Hd3a promotes heading under short-day conditions. The rice Heading date 1 (Hd1) gene, a homolog of CONSTANS (CO), has been shown to promote heading under short-day conditions. Besides, the amount of Hd3a mRNA is up-regulated by Hd1 under short-day conditions, suggesting that Hd3a promotes heading under the control of Hd1. These results indicate that Hd3a encodes a protein closely related to Arabidopsis FT and that the function and regulatory relationship with Hd1 and CO, respectively. Furthermore, Hd3a and FT are conserved between rice and Arabidopsis. (Kojima et al., 2002) | ||
| − | + | ||
===Homology=== | ===Homology=== | ||
Japanese scholars indicate, RICE FLOWERING LOCUS T1 (RFT1), and Heading date 3a (Hd3a) homology is the main activating factor of a long day under the conditions(Ogiso-Tanaka et al. 2013) | Japanese scholars indicate, RICE FLOWERING LOCUS T1 (RFT1), and Heading date 3a (Hd3a) homology is the main activating factor of a long day under the conditions(Ogiso-Tanaka et al. 2013) | ||
Revision as of 15:54, 10 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here. The rice photoperiod sensitivity gene Hd3 was originally detected as a heading date-related quantitative trait locus localized on chromosome 6 of rice. But the effect is small, it is a minor QTL located on chromosome 6 between RFLP markers R1952-C1032, and isolated with the four markers contain R2749, R1962, R2967 and C764 (Yamamoto et al., 1997). Furthermore, it was found the site of Hd3 was composed of two sub-sites Hd3a and Hd3b, both sites had additive effects. In the short daylight, Hd3a locus alleles from Kasalath promoted the heading; however, in the long sunshine or large fields, Hd3b locus alleles from Kasalath delayed heading. Hd3a and molecular markers B174 were separated as well as Hd3b and molecular markers R1952 did, the genetic distance is about 1.6cM (Monna, et al., 2002)
Expression
Please input expression information here. The full length of Hd3a cDNA is 847bp contains four exons encoding 178 amino acid protein products. Sequence analysis showed: Kasalath and Nipponbare allele coding region has a single base substitution, and a 2-synonymous nucleotide substitutions. this codon in Nipponbare is proline, while aspartic acid in Kasalath. And both alleles are functional, however, Hd3a in Kasalath promotes more powerful. The expression patterns of Hd1 and Hd3a were analyzed in different photoperiod and temperature conditions, revealing that Hd1 mRNA levels displayed similar expression patterns for different photoperiod and temperature treatments, with high expression levels at night and low levels in the daytime. In addition, Hd1 displayed a slightly higher expression level under long-day and low temperature conditions. Hd3a mRNA was present at a very low level under low temperature conditions regardless of the day-length. This result suggests that suppression of Hd3a expression is a principle cause of late heading under low temperature and long-day conditions. (Luan et al., 2009)
Evolution
Please input evolution information here. A previous study revealed that the Kasalath allele of Hd3a promotes heading under short-day conditions. The rice Heading date 1 (Hd1) gene, a homolog of CONSTANS (CO), has been shown to promote heading under short-day conditions. Besides, the amount of Hd3a mRNA is up-regulated by Hd1 under short-day conditions, suggesting that Hd3a promotes heading under the control of Hd1. These results indicate that Hd3a encodes a protein closely related to Arabidopsis FT and that the function and regulatory relationship with Hd1 and CO, respectively. Furthermore, Hd3a and FT are conserved between rice and Arabidopsis. (Kojima et al., 2002)
Homology
Japanese scholars indicate, RICE FLOWERING LOCUS T1 (RFT1), and Heading date 3a (Hd3a) homology is the main activating factor of a long day under the conditions(Ogiso-Tanaka et al. 2013)
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os06g0157700 |
|---|---|
| Description |
Similar to SP3D |
| Version |
NM_001063395.1 GI:115466521 GeneID:4340185 |
| Length |
2449 bp |
| Definition |
Oryza sativa Japonica Group Os06g0157700, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:2939005..2941453 |
| Sequence Coding Region |
2939157..2939363,2939526..2939587,2939721..2939761,2941069..2941298 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008399:2939005..2941453 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008399:2939005..2941453 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggccggaagtggcagggacagggaccctcttgtggttggtagggttgtgggtgatgtgctggacgcgttcgtccggagcaccaacctcaaggtcacctatggctccaagaccgtgtccaatggctgcgagctcaagccgtccatggtcacccaccagcctagggtcgaggtcggcggcaatgacatgaggacattctacacccttgtgatggtagacccagatgcaccaagcccaagtgaccctaaccttagggagtatctacattggttggtcactgatattcctggtactactgcagcgtcatttgggcaagaggtgatgtgctacgagagcccaaggccaaccatggggatccaccggctggtgttcgtgctgttccagcagctggggcgtcagacagtgtacgcgcccgggtggcgtcagaacttcaacaccaaggacttcgccgagctctacaacctcggctcgccggtcgccgccgtctacttcaactgccagcgcgaggcaggctccggcggcaggagggtctacccctag</cdnaseq> |
| Protein Sequence |
<aaseq>MAGSGRDRDPLVVGRVVGDVLDAFVRSTNLKVTYGSKTVSNGCE LKPSMVTHQPRVEVGGNDMRTFYTLVMVDPDAPSPSDPNLREYLHWLVTDIPGTTAAS FGQEVMCYESPRPTMGIHRLVFVLFQQLGRQTVYAPGWRQNFNTKDFAELYNLGSPVA AVYFNCQREAGSGGRRVYP</aaseq> |
| Gene Sequence |
<dnaseqindica>153..359#522..583#717..757#2065..2294#tgcaccacacacagttcagctagcagatcacctagctagatagctgcctctatcacagtatatttgctccctgcaacttgctgctgctgcaatagctagcagctgcagctagtaagcaaaactataaaccttcagggttttttgcaagatcgatggccggaagtggcagggacagggaccctcttgtggttggtagggttgtgggtgatgtgctggacgcgttcgtccggagcaccaacctcaaggtcacctatggctccaagaccgtgtccaatggctgcgagctcaagccgtccatggtcacccaccagcctagggtcgaggtcggcggcaatgacatgaggacattctacacccttgtatgtgagctctaccatgtgtcgtagttggtgcagagaccagaagttatactttctttcattattatattatagaaaaatttgtttggtacttaacccaagatgactttaaaatgcattaatttgatgtttgtcatggttttttgtggtgtgtacctgaaggtgatggtagacccagatgcaccaagcccaagtgaccctaaccttagggagtatctacattggtaagcacactaatgttaagctagcgcacttgttttcatgcaatgatcaaaataatcactgctagctgatttacatacataaccacatcttgactgcatgatgggttgatcatcttaatttgtttgtccacaggttggtcactgatattcctggtactactgcagcgtcatttggtcagtattaaacgatcaaatggtttagattgatttgatttcccacttaaatacattgcagtataaaactaacagaggtaaattgtctttccatactattgtttgggggggggggggcagggggcagtgagttgttgagcattttccctcactcgcgagcccccagtttgccgcattaattccccatcatccttcaccaccacaaaaaaaaaagtgatttggagaaggatacgctcctccaaataatttttaacaagttcaccaccacaacgaggcaccgacaaccgccatgagtccacgcaccctgcagctagtcgtgccaccagcaccacagttagccacaccgcgagcaatccacgccatcacttgccgctgtgagtccacgatcacacgcctcgatcagccagctgccatgatatgtcggcttgggcttggattctgcaacataccatgtccccatcgatggcaccacactctaattcgccaacacaacactgaagggatcggatcgggagggctagctcactcaagatagtgacgggatgattcgatgggaattccatggggaacaaagcacaaaatcattaaaatgtccttttcaattccatggcaaattcctaaagcaatactctctctccattctataatgtaggttgcacactcatttcaagattcaactttcaaaacatttgactaacgatttgtataatataaattgaattttatttgatagaaataatattattggattgatatttcaatatactttcatatggttataattttgttactacaaactttatagtatattagaaattataaataaaaaattagttttgtagaccgtacatgccaagtttgaccataccatattatgaaaaagagggagtagtaaccttgtttatatttgcaatatatactccctccgtttctaaatatctgacgctgttgactttttaaacatgtttgaccgttcgtcttattaaaaaataagtaattattaattcttttcctatcatttgatttattgttaaatatatttttatgcagacatatagttttacatatttcataaaagtttttgaataagaagaatgatcgtcaaatatttagaaacgaggggagtatattgctagtaaattttactgtaaagtcatgtttcttcatgtgtcttttttagaacatttcttcttcatgtgttccaatcaattttttcgatctccaccaccactaccacagttgtatgtgtagtagctagctgttgcacatgctcatgttaatctgaatctgtccatggttttttgcagggcaagaggtgatgtgctacgagagcccaaggccaaccatggggatccaccggctggtgttcgtgctgttccagcagctggggcgtcagacagtgtacgcgcccgggtggcgtcagaacttcaacaccaaggacttcgccgagctctacaacctcggctcgccggtcgccgccgtctacttcaactgccagcgcgaggcaggctccggcggcaggagggtctacccctagctaacgatgatcccgatcgatctgctgcatgctcactatcatcatccagcatgctatacattgcaggttcagacaattgaaatgattctcgacacacaacatatatatgatggtgtaattaattatgcaattaaatagctgagcaaggctaaggt</dnaseqindica> |
| External Link(s) |