Difference between revisions of "Os09g0439800"

From RiceWiki
Jump to: navigation, search
(Function)
(Annotated Information)
Line 2: Line 2:
  
 
==Annotated Information==
 
==Annotated Information==
 +
 +
===Function===
 
[[File:Figure1.jpeg|right|thumb|250px|'''Figure 1.''' ''Graphical genotypes (chromosomes 1–12) and vertical root distribution of IR64 and Dro1-NIL. (from reference<ref name="ref1" />).'']]
 
[[File:Figure1.jpeg|right|thumb|250px|'''Figure 1.''' ''Graphical genotypes (chromosomes 1–12) and vertical root distribution of IR64 and Dro1-NIL. (from reference<ref name="ref1" />).'']]
===Function===
 
 
This gene, named DEEPER ROOTING 1 (DRO1), is a rice quantitative trait locus controlling root growth angle. It is negatively regulated by auxin and is involved in cell elongation in the root tip that causes asymmetric root growth and downward bending  
 
This gene, named DEEPER ROOTING 1 (DRO1), is a rice quantitative trait locus controlling root growth angle. It is negatively regulated by auxin and is involved in cell elongation in the root tip that causes asymmetric root growth and downward bending  
 
of the root in response to gravity. Higher expression of DRO1 increases the root growth angle, whereby roots grow in a more  
 
of the root in response to gravity. Higher expression of DRO1 increases the root growth angle, whereby roots grow in a more  

Revision as of 02:45, 11 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Figure 1. Graphical genotypes (chromosomes 1–12) and vertical root distribution of IR64 and Dro1-NIL. (from reference[1]).

This gene, named DEEPER ROOTING 1 (DRO1), is a rice quantitative trait locus controlling root growth angle. It is negatively regulated by auxin and is involved in cell elongation in the root tip that causes asymmetric root growth and downward bending of the root in response to gravity. Higher expression of DRO1 increases the root growth angle, whereby roots grow in a more downward direction[1].

GO assignment(s): GO:0009734

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

  • National Institute of Agrobiological Sciences (NIAS), Tsukuba, Japan.
  • International Center for Tropical Agriculture (CIAT), Cali, Colombia.
  • Faculty of Science, University of Valle, Cali, Colombia.

References

  1. 1.0 1.1 Yusaku Uga, Kazuhiko Sugimoto, Satoshi Ogawa, Jagadish Rane, Manabu Ishitani,et al. (2013) Control of root system architecture by DEEPER ROOTING 1 increases rice yield under drought conditions. Nature Genetics 45: 1097–1102.

Structured Information

Gene Name

Os09g0439800

Description

Conserved hypothetical protein

Version

NM_001069813.1 GI:115479368 GeneID:4347169

Length

3058 bp

Definition

Oryza sativa Japonica Group Os09g0439800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:16961491..16964548

Sequence Coding Region

16961864..16961883,16961980..16962151,16962243..16962721,16964085..16964163,16964280..16964285

Expression

GEO Profiles:Os09g0439800

Genome Context

<gbrowseImage1> name=NC_008402:16961491..16964548 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:16961491..16964548 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgaagattttcagctgggtagccaacaagatcagtgggaagcaagaagcaaatcggtttcccgcaaattcttctgcgccttaccgtgctaacgtgtcagattgtcgaaaggatgaattcagtgattggccccaatcattgcttgctattgggacatttggaaataagcagattgaggaggtagctcaggtggagaattcatccgacaatgtgcagtcagtgcaagataccgtcaaatttacagaggaagaagtagacaagatacggaaagaattcgaaacgctactagcaatcaaagatcaagcagaagctcaacgctcgcatgatgatgaccaagtaggtttacaaaagcgtgccgatggggaagacaatgagaagcatattagacagttgatcaacaaaaggatcattgtaagtaaatcaaagaattcgttaggaaagaaaggaaatacactcaagccgagatcagtcgcttcgttgctcaagttattcatgtgtaagggtggctttacctccgtagttccagaaccaaggaacacatttcctcaatcaagaatggagaagttgctcaaggcaatattgcagaagaaaatacacccgcaaaattcttccacgctagttgctaagaggcatttggactggaagccagatgagacagaaatcaatgagtgcctggaggatgcactgcgtgatctagacgatgatggtgcaaaatgggtcaaaactgattcagagtatattgtgcttgaaatgtaa</cdnaseq>

Protein Sequence

<aaseq>MKIFSWVANKISGKQEANRFPANSSAPYRANVSDCRKDEFSDWP QSLLAIGTFGNKQIEEVAQVENSSDNVQSVQDTVKFTEEEVDKIRKEFETLLAIKDQA EAQRSHDDDQVGLQKRADGEDNEKHIRQLINKRIIVSKSKNSLGKKGNTLKPRSVASL LKLFMCKGGFTSVVPEPRNTFPQSRMEKLLKAILQKKIHPQNSSTLVAKRHLDWKPDE TEINECLEDALRDLDDDGAKWVKTDSEYIVLEM</aaseq>

Gene Sequence

<dnaseqindica>2666..2685#2398..2569#1828..2306#386..464#264..269#agatgaagtatagcaagctatcctacagccagccacgctgcaccgaaccctccaatccttggaacttgaaccccttcaaatcacacccagtaggctactagtagtacttctctgcaccaattccatcgccaatagcagccactacaagtcttacatctctcctttcctcctctctctgccattgctaggagcttgcatttcttggtagcttcatcagctagctgctttctccctccccaatctctcattcttcaggccaggatatgaaggtaaaggctcaaaccatcggtgtgattaatcatttcagagaggttaatagatttgaagtgttggtagtgttgatccatttcttgatggcatcatgaggcttgggttttctctgcagattttcagctgggtagccaacaagatcagtgggaagcaagaagcaaatcggtttcccgcaaattcttctgcgccttaccgtgagtgtacctgaactttcagtttccttgtaaattctttcagaactaaggtgattgttgttcaccaggcttcatgctgttcttatgaaatgtttccctgttccttgaggggagagggagagtacggacagtaatttggaagccgtttcctaatttgatattttctttctgtcattctgctgcagttataatgtctttacctcttagcagtttctgcttaggcatcatttgccttattcatttctggatacgatgatactttattgctttgtcctaatttaatcttttcctgctgtcattctgctccatttatggtgtctttacctcttagcagtttccgcttaggcatcatttgccatgttcatttctgaatatgctgatatactttgttgtcttggtagccatatacaagagtgaacgatttaaaggtttctcctaattgctagtaacagaacgcttttcgctctgcgattttctggattaccatcccctgattcctgagtaacctatcacaacgccaatgtgatggagcaaacattgatgtattatgacaatgttgtttctgatcctttgagaaaattttcttatatgcacttgggtgttgtttggaacgcaggaatttcactggaaacagttcaattatcgcacttccggaaaaaaaattcctgcattttaaacggcgctttaagttcagtaggagttttcaattttattttcctcttccctagcacgaaaagtgagagatttttgtgcatatgttatacccccaaaggactatttcatggcctgatgcccgccacgccaatatctctgtaaagcactgcttccaactagtcagtatgggtcaaagtcttgactaagtgcaaccctgcaagcaagtgtttccaactagtcagtatggcttcaattatttagttgatttataaccccaaccctccacttgtgaccaagaagaatttgatttgagcagacaatatcctgacctcggatggtttcgtaaatcgtactaaggaatcagatctgagccactagtccagctggactacagtacattatttatctctcaagattacataaaaagactactattgtacagagaatgcattgtttaagtggtaacaactgctgtgataagttattcctggtatacagaaaaatggcaggtgaaaacatcagggagtggagtaagcatgggcagacattgtacttaaagagtgataggccaatgagaatcactgggtgtttaaggattaaaaatttgtggtccatgctctagacatccaatttatgctaatatgaacttaggaccatatatttatgtttgtttactgatcttgcggcttaatcgagttctaatgcgcaggtgctaacgtgtcagattgtcgaaaggatgaattcagtgattggccccaatcattgcttgctattgggacatttggaaataagcagattgaggaggtagctcaggtggagaattcatccgacaatgtgcagtcagtgcaagataccgtcaaatttacagaggaagaagtagacaagatacggaaagaattcgaaacgctactagcaatcaaagatcaagcagaagctcaacgctcgcatgatgatgaccaagtaggtttacaaaagcgtgccgatggggaagacaatgagaagcatattagacagttgatcaacaaaaggatcattgtaagtaaatcaaagaattcgttaggaaagaaaggaaatacactcaagccgagatcagtcgcttcgttgctcaagttattcatgtgtaagggtggctttacctccgtagttccagaaccaaggaacacatttcctcaatcaagaatggagaaggtacacagtgaaattctttttttcttatgtaacatgataagttttacatactttctcgtcctcttattatcttatatgatgttcattgcagttgctcaaggcaatattgcagaagaaaatacacccgcaaaattcttccacgctagttgctaagaggcatttggactggaagccagatgagacagaaatcaatgagtgcctggaggatgcactgcgtgatctagacgatgatggtgcaaaatgggtcaaaactgattcagagtgtaagtagcatacttgcctatcatgaattgaaccttttcttttgccacttttgtcaatggagcaactgactgaatatgaacttttcttgtttccagatattgtgcttgaaatgtaaagttgggtgaatatgttagttcgttcatgccaggtatatacctttctttgatccccaaattttcaactcaactcaaatgtgaattatccttgatctagcatgtctctctgttttgatctgattagtgtgattccaatctgcaggttccaaaggtcctggcaagcttggggtttatggtgttactacgtaatgatataaatatgggatatagttagcaatgaagctctatgatcatgtaatgctcctccattatttctgacatgaaccatctgtaatttgaatcatgataaggaggttctgggacaaaggcctattccatgtgtctactctcttctgccctgaaactgtaaagaacgcattcaattttttcaac</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0439800, RefSeq:Os09g0439800