Difference between revisions of "Os09g0439800"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Mutation)
Line 12: Line 12:
 
===Mutation===
 
===Mutation===
 
Comparing the sequence of this ORF in the IR64 (a leading paddy cultivar widely grown in Asia, showed shallow rooting in an upland field) and KP (an upland cultivar from the Philippines, showed deep rooting) accessions identified a single 1-bp deletion within exon 4 in IR64 (Fig. 1b), resulting in the introduction of a premature stop codon. Transforming an 8.7-kb genomic fragment of KP containing the candidate gene into IR64 increased the ratio of deep rooting (an index of downward root growth; Online Methods) compared to IR64 transformed with the vector control<ref name="ref1" />.
 
Comparing the sequence of this ORF in the IR64 (a leading paddy cultivar widely grown in Asia, showed shallow rooting in an upland field) and KP (an upland cultivar from the Philippines, showed deep rooting) accessions identified a single 1-bp deletion within exon 4 in IR64 (Fig. 1b), resulting in the introduction of a premature stop codon. Transforming an 8.7-kb genomic fragment of KP containing the candidate gene into IR64 increased the ratio of deep rooting (an index of downward root growth; Online Methods) compared to IR64 transformed with the vector control<ref name="ref1" />.
[[File:FigureYL1.jpg|center|thumb|680px|'''Figure 2.''' ''Mutation and Structure of DRO1 based on annotation of Os09g0439800 (LOC_Os09g26840.1) (from reference<ref name="ref1" />).'']]
+
[[File:FigureYL2.jpg|center|thumb|680px|'''Figure 2.''' ''Mutation and Structure of DRO1 based on annotation of Os09g0439800 (LOC_Os09g26840.1) (from reference<ref name="ref1" />).'']]
 +
 
 
===Expression===
 
===Expression===
 
The predicted protein product of  DRO1 has no similarity to known proteins. Genes found in monocots had higher homology to DRO1 than genes found in dicots, DRO1 is not predicted to encode a signal peptide or a transmembrane domain but is predicted to encode two putative N-myristoylation sites associated with lipid modification,suggesting that DRO1 is associated with a membrane protein or with the plasma membrane<ref name="ref1" />.
 
The predicted protein product of  DRO1 has no similarity to known proteins. Genes found in monocots had higher homology to DRO1 than genes found in dicots, DRO1 is not predicted to encode a signal peptide or a transmembrane domain but is predicted to encode two putative N-myristoylation sites associated with lipid modification,suggesting that DRO1 is associated with a membrane protein or with the plasma membrane<ref name="ref1" />.

Revision as of 03:50, 11 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Figure 1. Graphical genotypes (chromosomes 1–12) and vertical root distribution of IR64 and Dro1-NIL. (from reference[1]).

This gene, named DEEPER ROOTING 1 (DRO1), is a rice quantitative trait locus controlling root growth angle(Figure 1). It is negatively regulated by auxin and is involved in cell elongation in the root tip that causes asymmetric root growth and downward bending of the root in response to gravity. Higher expression of DRO1 increases the root growth angle, whereby roots grow in a more downward direction[1].

GO assignment(s): GO:0009734

Mutation

Comparing the sequence of this ORF in the IR64 (a leading paddy cultivar widely grown in Asia, showed shallow rooting in an upland field) and KP (an upland cultivar from the Philippines, showed deep rooting) accessions identified a single 1-bp deletion within exon 4 in IR64 (Fig. 1b), resulting in the introduction of a premature stop codon. Transforming an 8.7-kb genomic fragment of KP containing the candidate gene into IR64 increased the ratio of deep rooting (an index of downward root growth; Online Methods) compared to IR64 transformed with the vector control[1].

Figure 2. Mutation and Structure of DRO1 based on annotation of Os09g0439800 (LOC_Os09g26840.1) (from reference[1]).

Expression

The predicted protein product of DRO1 has no similarity to known proteins. Genes found in monocots had higher homology to DRO1 than genes found in dicots, DRO1 is not predicted to encode a signal peptide or a transmembrane domain but is predicted to encode two putative N-myristoylation sites associated with lipid modification,suggesting that DRO1 is associated with a membrane protein or with the plasma membrane[1].

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

  • National Institute of Agrobiological Sciences (NIAS), Tsukuba, Japan.
  • International Center for Tropical Agriculture (CIAT), Cali, Colombia.
  • Faculty of Science, University of Valle, Cali, Colombia.

References

  1. 1.0 1.1 1.2 1.3 1.4 Yusaku Uga, Kazuhiko Sugimoto, Satoshi Ogawa, Jagadish Rane, Manabu Ishitani,et al. (2013) Control of root system architecture by DEEPER ROOTING 1 increases rice yield under drought conditions. Nature Genetics 45: 1097–1102.

Structured Information

Gene Name

Os09g0439800

Description

Conserved hypothetical protein

Version

NM_001069813.1 GI:115479368 GeneID:4347169

Length

3058 bp

Definition

Oryza sativa Japonica Group Os09g0439800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:16961491..16964548

Sequence Coding Region

16961864..16961883,16961980..16962151,16962243..16962721,16964085..16964163,16964280..16964285

Expression

GEO Profiles:Os09g0439800

Genome Context

<gbrowseImage1> name=NC_008402:16961491..16964548 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:16961491..16964548 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgaagattttcagctgggtagccaacaagatcagtgggaagcaagaagcaaatcggtttcccgcaaattcttctgcgccttaccgtgctaacgtgtcagattgtcgaaaggatgaattcagtgattggccccaatcattgcttgctattgggacatttggaaataagcagattgaggaggtagctcaggtggagaattcatccgacaatgtgcagtcagtgcaagataccgtcaaatttacagaggaagaagtagacaagatacggaaagaattcgaaacgctactagcaatcaaagatcaagcagaagctcaacgctcgcatgatgatgaccaagtaggtttacaaaagcgtgccgatggggaagacaatgagaagcatattagacagttgatcaacaaaaggatcattgtaagtaaatcaaagaattcgttaggaaagaaaggaaatacactcaagccgagatcagtcgcttcgttgctcaagttattcatgtgtaagggtggctttacctccgtagttccagaaccaaggaacacatttcctcaatcaagaatggagaagttgctcaaggcaatattgcagaagaaaatacacccgcaaaattcttccacgctagttgctaagaggcatttggactggaagccagatgagacagaaatcaatgagtgcctggaggatgcactgcgtgatctagacgatgatggtgcaaaatgggtcaaaactgattcagagtatattgtgcttgaaatgtaa</cdnaseq>

Protein Sequence

<aaseq>MKIFSWVANKISGKQEANRFPANSSAPYRANVSDCRKDEFSDWP QSLLAIGTFGNKQIEEVAQVENSSDNVQSVQDTVKFTEEEVDKIRKEFETLLAIKDQA EAQRSHDDDQVGLQKRADGEDNEKHIRQLINKRIIVSKSKNSLGKKGNTLKPRSVASL LKLFMCKGGFTSVVPEPRNTFPQSRMEKLLKAILQKKIHPQNSSTLVAKRHLDWKPDE TEINECLEDALRDLDDDGAKWVKTDSEYIVLEM</aaseq>

Gene Sequence

<dnaseqindica>2666..2685#2398..2569#1828..2306#386..464#264..269#agatgaagtatagcaagctatcctacagccagccacgctgcaccgaaccctccaatccttggaacttgaaccccttcaaatcacacccagtaggctactagtagtacttctctgcaccaattccatcgccaatagcagccactacaagtcttacatctctcctttcctcctctctctgccattgctaggagcttgcatttcttggtagcttcatcagctagctgctttctccctccccaatctctcattcttcaggccaggatatgaaggtaaaggctcaaaccatcggtgtgattaatcatttcagagaggttaatagatttgaagtgttggtagtgttgatccatttcttgatggcatcatgaggcttgggttttctctgcagattttcagctgggtagccaacaagatcagtgggaagcaagaagcaaatcggtttcccgcaaattcttctgcgccttaccgtgagtgtacctgaactttcagtttccttgtaaattctttcagaactaaggtgattgttgttcaccaggcttcatgctgttcttatgaaatgtttccctgttccttgaggggagagggagagtacggacagtaatttggaagccgtttcctaatttgatattttctttctgtcattctgctgcagttataatgtctttacctcttagcagtttctgcttaggcatcatttgccttattcatttctggatacgatgatactttattgctttgtcctaatttaatcttttcctgctgtcattctgctccatttatggtgtctttacctcttagcagtttccgcttaggcatcatttgccatgttcatttctgaatatgctgatatactttgttgtcttggtagccatatacaagagtgaacgatttaaaggtttctcctaattgctagtaacagaacgcttttcgctctgcgattttctggattaccatcccctgattcctgagtaacctatcacaacgccaatgtgatggagcaaacattgatgtattatgacaatgttgtttctgatcctttgagaaaattttcttatatgcacttgggtgttgtttggaacgcaggaatttcactggaaacagttcaattatcgcacttccggaaaaaaaattcctgcattttaaacggcgctttaagttcagtaggagttttcaattttattttcctcttccctagcacgaaaagtgagagatttttgtgcatatgttatacccccaaaggactatttcatggcctgatgcccgccacgccaatatctctgtaaagcactgcttccaactagtcagtatgggtcaaagtcttgactaagtgcaaccctgcaagcaagtgtttccaactagtcagtatggcttcaattatttagttgatttataaccccaaccctccacttgtgaccaagaagaatttgatttgagcagacaatatcctgacctcggatggtttcgtaaatcgtactaaggaatcagatctgagccactagtccagctggactacagtacattatttatctctcaagattacataaaaagactactattgtacagagaatgcattgtttaagtggtaacaactgctgtgataagttattcctggtatacagaaaaatggcaggtgaaaacatcagggagtggagtaagcatgggcagacattgtacttaaagagtgataggccaatgagaatcactgggtgtttaaggattaaaaatttgtggtccatgctctagacatccaatttatgctaatatgaacttaggaccatatatttatgtttgtttactgatcttgcggcttaatcgagttctaatgcgcaggtgctaacgtgtcagattgtcgaaaggatgaattcagtgattggccccaatcattgcttgctattgggacatttggaaataagcagattgaggaggtagctcaggtggagaattcatccgacaatgtgcagtcagtgcaagataccgtcaaatttacagaggaagaagtagacaagatacggaaagaattcgaaacgctactagcaatcaaagatcaagcagaagctcaacgctcgcatgatgatgaccaagtaggtttacaaaagcgtgccgatggggaagacaatgagaagcatattagacagttgatcaacaaaaggatcattgtaagtaaatcaaagaattcgttaggaaagaaaggaaatacactcaagccgagatcagtcgcttcgttgctcaagttattcatgtgtaagggtggctttacctccgtagttccagaaccaaggaacacatttcctcaatcaagaatggagaaggtacacagtgaaattctttttttcttatgtaacatgataagttttacatactttctcgtcctcttattatcttatatgatgttcattgcagttgctcaaggcaatattgcagaagaaaatacacccgcaaaattcttccacgctagttgctaagaggcatttggactggaagccagatgagacagaaatcaatgagtgcctggaggatgcactgcgtgatctagacgatgatggtgcaaaatgggtcaaaactgattcagagtgtaagtagcatacttgcctatcatgaattgaaccttttcttttgccacttttgtcaatggagcaactgactgaatatgaacttttcttgtttccagatattgtgcttgaaatgtaaagttgggtgaatatgttagttcgttcatgccaggtatatacctttctttgatccccaaattttcaactcaactcaaatgtgaattatccttgatctagcatgtctctctgttttgatctgattagtgtgattccaatctgcaggttccaaaggtcctggcaagcttggggtttatggtgttactacgtaatgatataaatatgggatatagttagcaatgaagctctatgatcatgtaatgctcctccattatttctgacatgaaccatctgtaatttgaatcatgataaggaggttctgggacaaaggcctattccatgtgtctactctcttctgccctgaaactgtaaagaacgcattcaattttttcaac</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0439800, RefSeq:Os09g0439800