Difference between revisions of "Os06g0610300"
Yonglejiang (talk | contribs) (→Function) |
Yonglejiang (talk | contribs) (→Function) |
||
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | The | + | The '''MOC1''' gene plays an important role in the control of rice tillering, encoding a putative GRAS family nuclear protein that is expressed mainly in the axillary buds and functions to initiate axillary buds and to promote their outgrowth<ref name="ref1" /><ref name="ref2" />. In the case of the rice plant, more tillering equates to more grain-bearing branches, hence a higher grain yield. Besides, as an member of the plant-specific GRAS family proteins that function in diverse aspects of plant development, including signal transduction, meristem maintenance and development<ref name="ref3" /><ref name="ref4" />., and as transcription factors <ref name="ref5" />, MOC1 might also function as a transcription factor<ref name="ref1" />. MOC1 is highly homologous with the tomato Lateral suppressor (Ls) gene<ref name="ref1" />. Ls loss-of-function mutations cause a branchless phenotype owing to a failure in axillary meristem initiation<ref name="ref6" />.. These results suggest that both Ls and MOC1 function as positive regulators of lateral branching. |
===Expression=== | ===Expression=== | ||
Revision as of 07:58, 11 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
The MOC1 gene plays an important role in the control of rice tillering, encoding a putative GRAS family nuclear protein that is expressed mainly in the axillary buds and functions to initiate axillary buds and to promote their outgrowth[1][2]. In the case of the rice plant, more tillering equates to more grain-bearing branches, hence a higher grain yield. Besides, as an member of the plant-specific GRAS family proteins that function in diverse aspects of plant development, including signal transduction, meristem maintenance and development[3][4]., and as transcription factors [5], MOC1 might also function as a transcription factor[1]. MOC1 is highly homologous with the tomato Lateral suppressor (Ls) gene[1]. Ls loss-of-function mutations cause a branchless phenotype owing to a failure in axillary meristem initiation[6].. These results suggest that both Ls and MOC1 function as positive regulators of lateral branching.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Structured Information
| Gene Name |
Os06g0610300 |
|---|---|
| Description |
Conserved hypothetical protein |
| Version |
NM_001064587.1 GI:115468905 GeneID:4341506 |
| Length |
626 bp |
| Definition |
Oryza sativa Japonica Group Os06g0610300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:25189473..25190098 |
| Sequence Coding Region |
25189730..25189909 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008399:25189473..25190098 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008399:25189473..25190098 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgcaatgtgaaacactgacacagctagaccaggtgtggggggtgtgcttgttcttgttgcaaggaagttatctggaggccatcatcaatgaagatcccaccaagggacaaaacatgagatggttggagacttgggtctgtctagtctctattcaaccatttaaagcattgcgtgtgtag</cdnaseq> |
| Protein Sequence |
<aaseq>MQCETLTQLDQVWGVCLFLLQGSYLEAIINEDPTKGQNMRWLET WVCLVSIQPFKALRV</aaseq> |
| Gene Sequence |
<dnaseqindica>258..437#attcactcatgagttaaaattttactcggagttaaattttaactcatgatgacgtaaacgaatctcggacgtccatttctcgatccaatggtagttttcaagttttcactacatatgtggtttgtactgtatattttcccttgcatctccatgtatctcaaaagttacatgagtggcacttgctactgtgcatgtagtatgtgtagcagctaggttataaatttctttatgtgtaacatgtgtgtgatgcatagtatatgcaatgtgaaacactgacacagctagaccaggtgtggggggtgtgcttgttcttgttgcaaggaagttatctggaggccatcatcaatgaagatcccaccaagggacaaaacatgagatggttggagacttgggtctgtctagtctctattcaaccatttaaagcattgcgtgtgtaggctacactcggagagagaacacagagcagccgtccaaaccgtctgaaatgataacttactctaagctagtaggagtgctagtagtaccctctatatgtgcaattttattcgttaaaaaggtttccatgcatgcttttttagtttatcaatagcctaaaccttttgaattattaagagttaattagtccc</dnaseqindica> |
| External Link(s) |
- ↑ 1.0 1.1 1.2 Cite error: Invalid
<ref>tag; no text was provided for refs namedref1 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref2 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref3 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref4 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref5 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref6