Difference between revisions of "Os05g0407500"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Labs working on this gene)
Line 14: Line 14:
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
Bioscience and Biotechnology Center, Nagoya University, Nagoya 464-8601, Japan
 +
BioResources Center, Riken, Tsukuba 305-0074, Japan
 +
College of Life Science, QAU, Qingdao 266109, China
 +
Department of Biotechnology, Maebashi Institute of Technology, Gunma 371-0816, Japan
 +
Department of Structural Biology, Graduate School of Pharmaceutical Sciences, Kyoto University, Sakyo-ku, Kyoto 606-8501, Japan
 +
Department of Applied Biological Chemistry, The University of Tokyo, Tokyo 113-8657, Japan
 +
Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya 464-8601, Japan
 +
Institute of Botany Academia, Sinica, Taipei 11529, Taiwan
 +
Key Laboratory of Crop Genetics and Physiology of Jiangsu Province, Key Laboratory of Plant Functional Genomics of Ministry of Education, Yangzhou University, Yangzhou 225009, China
 +
National Institute of Agrobiological Sciences, Tsukuba 305-8602, Japan
  
 
==References==
 
==References==

Revision as of 01:54, 12 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Gibberellin-insensitive dwarf1 (gid1), a recessive gibberellin (GA)-insensitive dwarf mutant of rice, shows a severe dwarf phenotype and contains high concentrations of endogenous GA (Tanaka et al., 2006). GID1 is a soluble receptor mediating GA signalling in rice, and it encodes an unknown protein with similarity to the hormone-sensitive lipases; preferential localization of a GID1–green fluorescent protein (GFP) signal in nuclei (Miyako et al., 2005). A gid1-1/slr1-1 double mutant exhibited the slr1-1 phenotype, indicating that GID1 and SLR1 function in the same GA signalling pathway and that SLR1 is epistatic to GID1 (Miyako et al., 2005). Among the proteins hyper-accumulated in gid1 were osmotin, triosephosphate isomerase, probenazole inducible protein (PBZ1) and pathogenesis-related protein 10.Gid1 is involved intolerance to cold stress and resistance to blast fungus. (Tanaka et al., 2006)

Expression

The GID1 gene contains one intron and two exons, and encodes a 354-amino-acid polypeptide (Miyako et al., 2005).GID1 overexpression resulted in a GA-hypersensitive phenotype (Miyako et al., 2005). Expression of this gene was enhanced in shoots of the wild type by cold stress or by rice blast fungus infection. The entcopalyl diphosphate synthase (OsCPS) genes, which encode enzymes at the branch point between GA and phytoalexin biosynthesis, were expressed differentially in gid1relative to the wild type. Specifically, OsCPS1, which encodes an enzyme in the GA biosynthesis pathway, was down-regulated and OsCPS2 and OsCPS4, which encode enzymes in phytoalexin biosynthesis, were up-regulated in gid1 (Tanaka et al., 2006)

Evolution

A database search revealed that there is no gene homologous to GID1 in rice, whereas there are three homologues in Arabidopsis, which are annotated as unknown proteins. However, an NCBI Conserved Domain Search indicated that GID1shares homology with the consensus sequence of the hormonesensitive lipase (HSL) family19, including the conserved HSL motifs HGG and GXSXG (Miyako et al., 2005). According to EST sequences, amino acid sequences coding these genes w ere deduced in sorghum, wheat maize (G ID1A and G ID1B) and cotton. Their amino acid sequences had higher similarity to rice with 81.44%, 81.36%, 80.50%, 79.14%, 63.13%, respectively (Sui Jiong-ming, 2009).

You can also add sub-section(s) at will.

Labs working on this gene

Bioscience and Biotechnology Center, Nagoya University, Nagoya 464-8601, Japan BioResources Center, Riken, Tsukuba 305-0074, Japan College of Life Science, QAU, Qingdao 266109, China Department of Biotechnology, Maebashi Institute of Technology, Gunma 371-0816, Japan Department of Structural Biology, Graduate School of Pharmaceutical Sciences, Kyoto University, Sakyo-ku, Kyoto 606-8501, Japan Department of Applied Biological Chemistry, The University of Tokyo, Tokyo 113-8657, Japan Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya 464-8601, Japan Institute of Botany Academia, Sinica, Taipei 11529, Taiwan Key Laboratory of Crop Genetics and Physiology of Jiangsu Province, Key Laboratory of Plant Functional Genomics of Ministry of Education, Yangzhou University, Yangzhou 225009, China National Institute of Agrobiological Sciences, Tsukuba 305-8602, Japan

References

Please input cited references here.

Structured Information

Gene Name

Os05g0407500

Description

Esterase/lipase/thioesterase domain containing protein

Version

NM_001062055.1 GI:115463840 GeneID:4338764

Length

2799 bp

Definition

Oryza sativa Japonica Group Os05g0407500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:19875298..19878096

Sequence Coding Region

19875720..19875758,19876402..19877427

Expression

GEO Profiles:Os05g0407500

Genome Context

<gbrowseImage1> name=NC_008398:19875298..19878096 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:19875298..19878096 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccggcagcgacgaggtcaaccgcaacgagtgcaagacggtggtgccgctccacacatgggtgctcatctccaacttcaagctgtcgtacaacattctgcggcgggcggacgggacgttcgagcgggacctcggggagtacctggacaggagggtgccggcgaacgcgcggccgctggagggggtgtcgtcgttcgaccacatcatcgaccagtcggtggggctggaggtgcgcatctaccgggcggcggcggagggtgacgcggaggagggggcggcggcggtgacgcggcccatccttgagttcctgacggacgcgccagcggcggagccgttcccggtgatcatattcttccacggcggcagcttcgtgcactcgtcggccagctcgaccatctacgacagtctgtgccgccggttcgtgaagctgagcaagggcgtcgtggtgtccgtcaactaccggcgcgcgccggagcaccgctacccgtgcgcgtacgacgacgggtggaccgcgctcaagtgggtcatgtcgcagccgttcatgcgcagcggcggcgacgcgcaggcccgcgtgttcctctccggcgacagctccggcggcaacatcgcccaccacgtcgccgtccgcgccgccgacgagggcgtcaaggtctgcggcaacatcctgctcaacgccatgttcggcggcaccgagcgcacggagtcggagcggcggctcgacggcaagtacttcgtgacgctccaggacagggactggtactggaaggcgtacctgccggaggacgccgaccgggaccatccggcgtgcaacccgttcggcccgaacggccggcggctcgggggcctccccttcgccaagagcctcatcatcgtgtcgggcctggacctcacctgcgaccggcagctcgcctacgccgacgccctccgggaggacggccaccacgtcaaggttgtccaatgcgagaacgccacggtggggttctacctgttgcccaacaccgtccactaccacgaggtcatggaggagatctccgacttcctcaacgctaacctctactactag</cdnaseq>

Protein Sequence

<aaseq>MAGSDEVNRNECKTVVPLHTWVLISNFKLSYNILRRADGTFERD LGEYLDRRVPANARPLEGVSSFDHIIDQSVGLEVRIYRAAAEGDAEEGAAAVTRPILE FLTDAPAAEPFPVIIFFHGGSFVHSSASSTIYDSLCRRFVKLSKGVVVSVNYRRAPEH RYPCAYDDGWTALKWVMSQPFMRSGGDAQARVFLSGDSSGGNIAHHVAVRAADEGVKV CGNILLNAMFGGTERTESERRLDGKYFVTLQDRDWYWKAYLPEDADRDHPACNPFGPN GRRLGGLPFAKSLIIVSGLDLTCDRQLAYADALREDGHHVKVVQCENATVGFYLLPNT VHYHEVMEEISDFLNANLYY</aaseq>

Gene Sequence

<dnaseqindica>423..461#1105..2130#tctccctgttcgttgccttctccgtgccgaacaccacagcgcgcgcgcgggggggcgggttcggctctctcgcgagctctgctctctgtccctctctctctctcgccgcctcctgcctcgcacactcgagattggtggggtggatttgggggaggaggaggtggggtggggtggggtggttgctgaggaggaggtggtggtgagagatcgggcggcgggttgccgccggaggaggtagagggatcctcgggggagggcggttcttgggtcgggggacccccccatggcgtgaggagagggtgccctccgggagatcttgcggggcgggtgtgtggtgttgctagctgaggctgttgggtgggtacccccgagcggccggggaatctcctcccttctcgagcgaccgcccgcgtcgctccgccatggccggcagcgacgaggtcaaccgcaacgagtgcaaggtgcgtgtgctcttccttcttgaaccccttccgctctctctcccgcggtggcgtgtgtgtccgtgtctgtcgcctccggattaggccgcggccgaggcggtcgcggttggggttcttgatttgcgccgccgcgcgcgccccgctcgctttatggtttgcggggggaaggatcgattggggccggcctggcctgcgatttggcggtcaatcgctgccttttctttcccctttgggctcagccccaattttatcccccctcgtgcttgcctcggccgttttagggcgggtggtgaactgtggtggtggtaatactgcctgcctgctgccggccgcagcggcagctacccaacaaagccggaagaaacccccattcacaatcaccgcggccgcccgtgttggttgggagcgttcgcgcgcgccaaagcttgcatctttgtggcaagcgcctctcgcattgggtttttttttttttttgggggggggggttgtttcttttttgtccgagcaggaatcagcaaagaaaaacatacgcatatgcacaccgattgattgattgctctggtttcgcttccgcgattgcgagatagtagtagtagtagagggtcgctcactgtggttgtggttgtggttggttgtggtgcagacggtggtgccgctccacacatgggtgctcatctccaacttcaagctgtcgtacaacattctgcggcgggcggacgggacgttcgagcgggacctcggggagtacctggacaggagggtgccggcgaacgcgcggccgctggagggggtgtcgtcgttcgaccacatcatcgaccagtcggtggggctggaggtgcgcatctaccgggcggcggcggagggtgacgcggaggagggggcggcggcggtgacgcggcccatccttgagttcctgacggacgcgccagcggcggagccgttcccggtgatcatattcttccacggcggcagcttcgtgcactcgtcggccagctcgaccatctacgacagtctgtgccgccggttcgtgaagctgagcaagggcgtcgtggtgtccgtcaactaccggcgcgcgccggagcaccgctacccgtgcgcgtacgacgacgggtggaccgcgctcaagtgggtcatgtcgcagccgttcatgcgcagcggcggcgacgcgcaggcccgcgtgttcctctccggcgacagctccggcggcaacatcgcccaccacgtcgccgtccgcgccgccgacgagggcgtcaaggtctgcggcaacatcctgctcaacgccatgttcggcggcaccgagcgcacggagtcggagcggcggctcgacggcaagtacttcgtgacgctccaggacagggactggtactggaaggcgtacctgccggaggacgccgaccgggaccatccggcgtgcaacccgttcggcccgaacggccggcggctcgggggcctccccttcgccaagagcctcatcatcgtgtcgggcctggacctcacctgcgaccggcagctcgcctacgccgacgccctccgggaggacggccaccacgtcaaggttgtccaatgcgagaacgccacggtggggttctacctgttgcccaacaccgtccactaccacgaggtcatggaggagatctccgacttcctcaacgctaacctctactactagtacatatacagcccctctccctctcccccctcgctgatcgtcgtctccaacacaaatactccttatagggaagatggtaattcagcttgactttgttatagtacctactactactactactactacctcctatactactgctgctgcttgggatcgcaatgccgtcgtctgctcttgtgtggcgaaggagaagctagctccatgctgtctgatcagctctaatcaaatggtgactcggttgcgtcgaggaagaagaagaaagtcgtccgtcgtcgtcgtccttgttccactaatcatcgttcatccttttctttttttgtggtttggatcgttctttgatccatgttttccatgttttgcctggggtcagtgtagtcaagacaagttgagggtagttccatgtctgtcatgcatgcctccattagtactactactgttgtgactttggttgatggagagaagaagcatgtttttttttcttttaatctcgcattccatccatcttctccatgtactccaaagagaggaaagttgctatctaacgttatgtgtacagtgatcgatcaacaaggagatttgaggaggcatgccccttttgttgctgttgatgttctagttttatcttctttcttgttaacaggattggatggtgctctcttgctcactctc</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0407500, RefSeq:Os05g0407500