Difference between revisions of "Os06g0139000"

From RiceWiki
Jump to: navigation, search
(Function: DDF1 is generally required for normal organ size in rice.DDF1 is also required for normal flower development in rice)
(Expression: ddf1-1 exhibits significant size reduction in the whole plant, except the spikelet)
Line 8: Line 8:
 
===Expression===
 
===Expression===
 
Please input expression information here.
 
Please input expression information here.
 +
The mutant ddf1-1 was discovered from a breeding population.The ddf1-1 plant is much shorter and thinner than the wild type, and this difference is distinct at the early seedling stage and becomes more apparent as the plants develop. The final plant height of the mutant reaches only about half of that of the wild type (Figure 1a–e and Figure S1). All vegetative organs in ddf1-1, including stems, internodes, leaves and roots (both fibrous and lateral), are significantly shorter and thinner than in the wild type (Figure 1f–j and Figures S2 and S3). In addition, the ddf1-1 panicle is also notably shorter and smaller, consisting of fewer primary and secondary branches and spikelets (Figure 1e,f; Figure S4). These phenotypes suggest that plant growth in ddf1-1 is seriously stunted. However, the size of the spikelet, the numbers of various vegetative organs (e.g. internodes and tillers; Figure S5) and the time from sowing to heading (Figure 1e) remain unaffected in ddf1-1.
  
 
===Evolution===
 
===Evolution===

Revision as of 14:27, 12 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. controlling monocot vegetative and reproductive development ddf1-1 exhibits significant size reduction in the whole plant, except the spikelet.Cell division and cell expansion are inhibited in ddf1-1.The expression of cell division/expansion-related genes is downregulated in ddf1-1.ddf1-1 also shows significant structural abnormalities in florets.The ddf1-1 phenotype is caused by a single nucleotide substitution.DDF1 encodes an LRR-type F-box protein, anchored in nucleolus.The expression pattern of DDF1 is consistent with the phenotypes of ddf1-1.DDF1 regulates the expression of several floral organ specification genes.DDF1 encodes an LRR-type F-box protein, anchored in nucleolus.The expression pattern of DDF1 is consistent with the phenotypes of ddf1-1.DDF1 regulates the expression of several floral organ specification genes.

Expression

Please input expression information here. The mutant ddf1-1 was discovered from a breeding population.The ddf1-1 plant is much shorter and thinner than the wild type, and this difference is distinct at the early seedling stage and becomes more apparent as the plants develop. The final plant height of the mutant reaches only about half of that of the wild type (Figure 1a–e and Figure S1). All vegetative organs in ddf1-1, including stems, internodes, leaves and roots (both fibrous and lateral), are significantly shorter and thinner than in the wild type (Figure 1f–j and Figures S2 and S3). In addition, the ddf1-1 panicle is also notably shorter and smaller, consisting of fewer primary and secondary branches and spikelets (Figure 1e,f; Figure S4). These phenotypes suggest that plant growth in ddf1-1 is seriously stunted. However, the size of the spikelet, the numbers of various vegetative organs (e.g. internodes and tillers; Figure S5) and the time from sowing to heading (Figure 1e) remain unaffected in ddf1-1.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os06g0139000

Description

Conserved hypothetical protein

Version

NM_001063278.1 GI:115466287 GeneID:4340059

Length

5003 bp

Definition

Oryza sativa Japonica Group Os06g0139000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:2056222..2061224

Sequence Coding Region

2056559..2056939,2057034..2057180,2057282..2058094

Expression

GEO Profiles:Os06g0139000

Genome Context

<gbrowseImage1> name=NC_008399:2056222..2061224 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:2056222..2061224 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgccaatgcgggatgctgcccgagctgcctgtgtgtctcattcctttctaagttcctggagatgccaccccaacctcaatttcagtagtgaagcattggggttgagcaaaaatgcatatggaaacgaagaattggctggacttttctacagcaaagtcaaccacattctcaaaaggcactcaggcatcggcgtgaaaaaactgacgattaaggtatattcagattatagtgggaagggctcttcatatctcaacaattggcttcagattgctgttaaaccagggattgaagaactcataattgcactgacccagttccaggcaaagtacaatttcccatgctctcttctgtcgaatgggagtggagactcaatccaatatcttcacctttctaactgttccttccacccaacagtcacacttagtggcttaagaagtctgacgagattgtatctttgtcgtgtgcgtattaccgagaacgagttaggctgccttctttcccattctcttgcattggagcagttggaaatcaggtactgcaataggatagtttgcctgaaggtaccttgcctactgcaacggctcatctccctgaaggtgtttgggtgtgacaagttgaaactgatagaaaatgaagctcctaatgtctccatgtttgcatttcaaggggacaaaacggaactgaaacttggagaaactttgcaaataaagagcctatgcatggtccgctctggttatgtttatcatgctcgtgctgaacttccatccatcatgccaaatcttgaatctcttgccctaaagtcatgcaaagagacggcctttgcaccgaagctgtgtagcaaattcctctgcctcaggcacttgagcattggccttattggatttttcccagcctatgactatttatccctggcttcttatatttatgctgcaccttctctggagacttttgacttgaatgtaatgcagcggaacgtgcagagtgtttcaatttttgcacatcctgcagatctgagatcaatacgagaagagaagcatcacaaccttaagagtgtgacggttacatcattcatctctgtaaagagcttggttgagctgacatgccatatccttgagagtacagcttcactcgagtgcttgacattggatgcttctcagactggttttaggtgtgatactccaggcagcaaaatcagcaaatgccccccactagatagggacattatcatggaaggtcacagaggggtcttggctatcagaagatacatccagcctagggtaccttccacagtgaagctgactgttttggagccctgcagctgccattccactgaactttag</cdnaseq>

Protein Sequence

<aaseq>MPMRDAARAACVSHSFLSSWRCHPNLNFSSEALGLSKNAYGNEE LAGLFYSKVNHILKRHSGIGVKKLTIKVYSDYSGKGSSYLNNWLQIAVKPGIEELIIA LTQFQAKYNFPCSLLSNGSGDSIQYLHLSNCSFHPTVTLSGLRSLTRLYLCRVRITEN ELGCLLSHSLALEQLEIRYCNRIVCLKVPCLLQRLISLKVFGCDKLKLIENEAPNVSM FAFQGDKTELKLGETLQIKSLCMVRSGYVYHARAELPSIMPNLESLALKSCKETAFAP KLCSKFLCLRHLSIGLIGFFPAYDYLSLASYIYAAPSLETFDLNVMQRNVQSVSIFAH PADLRSIREEKHHNLKSVTVTSFISVKSLVELTCHILESTASLECLTLDASQTGFRCD TPGSKISKCPPLDRDIIMEGHRGVLAIRRYIQPRVPSTVKLTVLEPCSCHSTEL</aaseq>

Gene Sequence

<dnaseqindica>4286..4666#4045..4191#3131..3943#gggctccttcctaaaattataactctgatatctatatctatcttgcctacaaattataactctcgttccccaattttgtgtgtgacgttgagaagtgccgaccggcgacgacgaaaggccggcggagagagatcccctcaccaccatggggatgctggatctgatgcgcctcatgtccatccagcgccagcgggaccaggagcgccgccgccgccaagcccaagctcccccccgtggtaaagaaactactcctcataagcttcctctcccacctccctctgtcactctctggtcaagcggcggcagcagcagcagcttcttgcgtttacggtgggggaagggaaccagatggacttgcttgcgcctctttttcctgtttcgttgggtgggtgtttatttagttttcttcacactagtttgtgtcgattattcgaatctgtatatatgtagtactagtatatacacaaaccaaaaagaaaaaaaaacatgtttttattgagcgcaaggtaggagatcaaaggtggtttatccgatccgccatggctggtggccggccaccaccgtcttgttccttttctctttaactagattgacgagacgtagggagagagactacactgtaactataaggtacccgcgtgttgctgcgggaattcttagaacaatatttgtgcgtatggtcgcatggatagcaaaaacactgaattgcattgaagtaagacaacctctttttgtgtgaatatggagttacggttttgttcaacattcaaatcagttgtgaaatatgaggatatatatcttggtagctgacaatttagatattaccgtgggcaacagaaaaagaaaaatgtttagtaatactgtgagaacttggctaatgatgataattcaaaatcatatacattgctccccaagttggataacagggttagcaaaaaaaaattcatattcagatatgaaagaaggttcagcagataaacatggctattaaaattcagttaccgaacaaggttcaccaactaaaaatttccatcaaaattaagagttttacgcacctcaatattatacttagactacgaatcaaccaactgatggtcttgtttcctgcattcttcaattgcttaaaaagaagaaaaggatctgacaatgaaaccacagctacatagggcatcgacagaaagtggttaaagttgtaactgcatatctacatagcagcatacgatagacacataattgaaaggtccagattagcatagcttcaagcatcataaaacatgaagctagtcatgggtggaaagattctgtggaaggacagggataataagcatattgatttgaacctgcgggagtggcatatcctgagagagataagttgtgttgggaaggctcatcagctagtgtcgttgaccagagtgagtttgtcatcgtcgccggaggatacagctcgtctttctctctcccatgaagatctggcagcatagctgagagcctttgagaggaaaggagaaggcatattgagggtaataaatgtccatggcggctgtcacttcaactcctagctgtttcaggttttgatagcgcgtttcagcctttcaggcgagggagactcaaaggtggacatagaagccgaatggctcagttctcttgcgtcgtgttgcgctgagagtggagatggaacgataggaggtaggatgttctggggtacgtaggaacgtttggttgggttttctgtgtgagagacactacattcaatctgatggaaattaaggggtgatgtggcaaagcgagatgaccaaaaaaatactattaattgcactaagtggggatgaattgtatcggtttataggatactatactatgcaaaataagaaaaatactatatgacatgctgaacttcagacatttccccttaaattgataacactttgatttcttttacaaactgttagtgttgttgtacaaaaggggacaaaaaaaaaaataacggattgccatgtgtgcaatggtgtgcttgcttgaattttctgtttattcctgaaatggatgtaaaccatgcatcttgtgctgcagatggattgattgctttacgggctaaaagaaaagggctcaccctgccaacaagacggcgattctcagggtgctgctgacatagagataccaagccttccagaggtacaccataaataaaatgttgatgatgaaacatcttactagtagtgtagtacaagtaaattatgacgattactgcttgaatcgcacaaatcggtcgaccaacgttattaaagtttatgaacggagcactttgatgctataacctcctacagctgctgcattggaactgtttttccagctgttgcacttactttcaattacaagttgtgtccacataatgcttgcttctaagctggtggttcttaggctgggagtttctcaagtcaacgtcaatgattagcctttgccactagtctccatactgtttctaacttccttaaattttaacatctcaaaaatggttccttgctaacaaatgtgacatgttatctccggtaggccattgcaggcagtacatggtaattttgtgagccacatgtccttgtaggatggcattcttgtttgattccccgcatctccccatcctgactccccgcatcttccccatcctgagttcctgacctagtgtatgaaaatccaagcaagcaaccaaacacacctttagttctgttacatatttaactgatctttctggttgtttatatattcagatattggtaccctatgcaaagtgcatgtccatttctgttccttttatgccattgaataacatgctattagacaattaaacatcattccatccattttatctggcacaattgcaaagaaacaaatagtgccgagcacctaatacatgatttgggtaagaccatatttgcctagcagaagtcaactatacaattcatagtacaatagtacataatcaggcaggtagcactggaccggttaaagtgttaactccataagttaccattttttttcttccatctaattcaaccatctgtcttcacaattccaatggttaacttctctcccatgcttgtgcaagcaggacatctggcgtcttatacattccttgatgccaatgcgggatgctgcccgagctgcctgtgtgtctcattcctttctaagttcctggagatgccaccccaacctcaatttcagtagtgaagcattggggttgagcaaaaatgcatatggaaacgaagaattggctggacttttctacagcaaagtcaaccacattctcaaaaggcactcaggcatcggcgtgaaaaaactgacgattaaggtatattcagattatagtgggaagggctcttcatatctcaacaattggcttcagattgctgttaaaccagggattgaagaactcataattgcactgacccagttccaggcaaagtacaatttcccatgctctcttctgtcgaatgggagtggagactcaatccaatatcttcacctttctaactgttccttccacccaacagtcacacttagtggcttaagaagtctgacgagattgtatctttgtcgtgtgcgtattaccgagaacgagttaggctgccttctttcccattctcttgcattggagcagttggaaatcaggtactgcaataggatagtttgcctgaaggtaccttgcctactgcaacggctcatctccctgaaggtgtttgggtgtgacaagttgaaactgatagaaaatgaagctcctaatgtctccatgtttgcatttcaaggggacaaaacggaactgaaacttggagaaactttgcaaataaagagcctatgcatggtccgctctggttatgtttatcatgctcgtgctgaacttccatccatcatgccaaatcttgaatctcttgccctaaagtcatgcaaagaggtatgagaaattttacctgacacactaatgataggcatatctaatgagactagattctgtcttatgggttgtagcataattaatttgacctctttatgcagacggcctttgcaccgaagctgtgtagcaaattcctctgcctcaggcacttgagcattggccttattggatttttcccagcctatgactatttatccctggcttcttatatttatgctgcaccttctctggagacttttgacttgaatgtgagtagctgttcatatattattactgctatgaatgaaattagtagctgtgtggtggaaatgtcacttaaaatttctccctttcacatcctaggtaatgcagcggaacgtgcagagtgtttcaatttttgcacatcctgcagatctgagatcaatacgagaagagaagcatcacaaccttaagagtgtgacggttacatcattcatctctgtaaagagcttggttgagctgacatgccatatccttgagagtacagcttcactcgagtgcttgacattggatgcttctcagactggttttaggtgtgatactccaggcagcaaaatcagcaaatgccccccactagatagggacattatcatggaaggtcacagaggggtcttggctatcagaagatacatccagcctagggtaccttccacagtgaagctgactgttttggagccctgcagctgccattccactgaactttagatgtcatgtttatcttagttattcgatgtttaatcgtgctgctgctgatgatgattctgtagattcttagatgggtcatggtttctaaagtttgctcttaatgattactactagttgatatcataaccaatgcacatgatatccactagtaactctagtttccacctagcagcagtgttgtatgcacattaaaaagttcttactagcagaagttctcgaacgtttgatttacctacttgtggccttgtgggttataaaaagctaaacattagagtttgtaacaaattttagtgtgtagcctttaatttcttttcacctatatatgcatcggtttctt</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0139000, RefSeq:Os06g0139000