Difference between revisions of "Os08g0509600"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(Annotated Information)
Line 4: Line 4:
 
===Function===
 
===Function===
  
The rice gene OsSPL14 plays an important role in controlling rice plant architecture as well as yield. OsSPL14 encodes a SQUAMOSA promoter-binding-like (SPL) protein, as a gene that can affect plant architecture[1]. Higher expression of OsSPL14 in the reproductive stage promotes panicle branching and higher grain yield in rice. OsSPL14 controls shoot branching in the vegetative stage and is affected by microRNA excision[2].
+
The rice gene OsSPL14 plays an important role in controlling rice plant architecture as well as yield. OsSPL14 encodes a SQUAMOSA promoter-binding-like (SPL) protein, as a gene that can affect plant architecture<ref name="ref1" />. Higher expression of OsSPL14 in the reproductive stage promotes panicle branching and higher grain yield in rice. OsSPL14 controls shoot branching in the vegetative stage and is affected by microRNA excision<ref name="ref2" />.
  
 
===Mutation===
 
===Mutation===
Jiao et al. demonstrate that a point mutation in OsSPL14 perturbs OsmiR156-directed regulation of OsSPL14, generating an‘ideal’ rice plant with a reduced tiller number, increased lodging resistance and enhanced grain yield[3].
+
Jiao et al. demonstrate that a point mutation in OsSPL14 perturbs OsmiR156-directed regulation of OsSPL14, generating an‘ideal’ rice plant with a reduced tiller number, increased lodging resistance and enhanced grain yield<ref name="ref3" />.
  
 
===Expression===
 
===Expression===
Luo et al. confirm that OsSPL14 is expressed in the leaf primordia but is excluded from the meristematic cells[4].
+
Luo et al. confirm that OsSPL14 is expressed in the leaf primordia but is excluded from the meristematic cells<ref name="ref4" />.
[[File:Expression pattern of OsSPL14.jpg|right|thumb|275px|'''Figure 1.''' ''Expression pattern of OsSPL14 <ref name="ref1" />.'']]
+
[[File:Expression pattern of OsSPL14.jpg|right|thumb|275px|'''Figure 1.''' ''Expression pattern of OsSPL14 <ref name="ref4" />.'']]
  
 
===Evolution===
 
===Evolution===
The rice OsSPL14 gene is the closest homolog of the Arabidopsis SPL9 and SPL15 genes and one of the 11 OsmiR156-targeted SPL genes of rice<ref name="ref1" />.
+
The rice OsSPL14 gene is the closest homolog of the Arabidopsis SPL9 and SPL15 genes and one of the 11 OsmiR156-targeted SPL genes of rice<ref name="ref4" />.
  
 
===Knowledge Extension===
 
===Knowledge Extension===

Revision as of 03:05, 13 May 2014

Please input one-sentence summary here.

Annotated Information

Function

The rice gene OsSPL14 plays an important role in controlling rice plant architecture as well as yield. OsSPL14 encodes a SQUAMOSA promoter-binding-like (SPL) protein, as a gene that can affect plant architecture[1]. Higher expression of OsSPL14 in the reproductive stage promotes panicle branching and higher grain yield in rice. OsSPL14 controls shoot branching in the vegetative stage and is affected by microRNA excision[2].

Mutation

Jiao et al. demonstrate that a point mutation in OsSPL14 perturbs OsmiR156-directed regulation of OsSPL14, generating an‘ideal’ rice plant with a reduced tiller number, increased lodging resistance and enhanced grain yield[3].

Expression

Luo et al. confirm that OsSPL14 is expressed in the leaf primordia but is excluded from the meristematic cells[4].

Figure 1. Expression pattern of OsSPL14 [4].

Evolution

The rice OsSPL14 gene is the closest homolog of the Arabidopsis SPL9 and SPL15 genes and one of the 11 OsmiR156-targeted SPL genes of rice[4].

Knowledge Extension

The SPL genes make up a plant-specific multigene family of transcription factors that can play roles in regulating plant morphology and the decision to flower[1].

Labs working on this gene

  • State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China
  • Graduate School of Agriculture and Life Sciences, University of Tokyo, Yayoi, Bunkyo, Tokyo 113-8657, Japan
  • Department of Bioscience, Fukui Prefectural University, 4-1-1 Matsuoka Kenjyojima, Eiheiji-cho, Yoshida-gun, Fukui 910-1195, Japan
  • Bioscience and Biotechnology Center, Nagoya University, Nagoya, Aichi 464-8601, Japan

References

  1. Luo L, Li W, Miura K, Ashikari M, Kyozuka J. Control of tiller growth of rice by OsSPL14 and Strigolactones, which work in two independent pathways[J]. Plant & cell physiology, 2012,53(10):1793-801.
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. 4.0 4.1 4.2 Cite error: Invalid <ref> tag; no text was provided for refs named ref4

Structured Information

Gene Name

Os08g0509600

Description

Similar to Squamosa-promoter binding-like protein 8

Version

NM_001068739.1 GI:115477215 GeneID:4345998

Length

4156 bp

Definition

Oryza sativa Japonica Group Os08g0509600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 8

Location

Chromosome 8:25362546..25366701

Sequence Coding Region

25362793..25363463,25363566..25363699,25366130..25366578

Expression

GEO Profiles:Os08g0509600

Genome Context

<gbrowseImage1> name=NC_008401:25362546..25366701 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:25362546..25366701 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagatggccagtggaggaggcgccgccgccgccgccggcggcggagtaggcggcagcggcggcggtggtggtggaggggacgagcaccgccagctgcacggtctcaagttcggcaagaagatctacttcgaggacgccgccgcggcagcaggcggcggcggcactggcagtggcagtggcagcgcgagcgccgcgccgccgtcctcgtcttccaaggcggcgggtggtggacgcggcggagggggcaagaacaaggggaagggcgtggccgcggcggcgccaccgccgccgccgccgccgccgcggtgccaggtggaggggtgcggcgcggatctgagcgggatcaagaactactactgccgccacaaggtgtgcttcatgcattccaaggctccccgcgtcgtcgtcgccggcctcgagcagcgcttctgccagcagtgcagcaggttccacctgctgcctgaatttgaccaaggaaaacgcagctgccgcagacgccttgcaggtcataatgagcgccggaggaggccgcaaacccctttggcatcacgctacggtcgactagctgcatctgttggtgagcatcgcaggttcagaagctttacgttggatttctcctacccaagggttccaagcagcgtaaggaatgcatggccagcaattcaaccaggcgatcggatctccggtggtatccagtggcacaggaacgtagctcctcatggtcactctagtgcagtggcgggatatggtgccaacacatacagcggccaaggtagctcttcttcagggccaccggtgttcgctggcccaaatctccctccaggtggatgtctcgcaggggtcggtgccgccaccgactcgagctgtgctctctctcttctgtcaacccagccatgggatactactacccacagtgccgctgccagccacaaccaggctgcagccatgtccactaccaccagctttgatggcaatcctgtggcaccctccgccatggcgggtagctacatggcaccaagcccctggacaggttctcggggccatgagggtggtggtcggagcgtggcgcaccagctaccacatgaagtctcacttgatgaggtgcaccctggtcctagccatcatgcccacttctccggtgagcttgagcttgctctgcaggggaacggtccagccccagcaccacgcatcgatcctgggtccggcagcaccttcgaccaaaccagcaacacgatggattggtctctgtag</cdnaseq>

Protein Sequence

<aaseq>MEMASGGGAAAAAGGGVGGSGGGGGGGDEHRQLHGLKFGKKIYF EDAAAAAGGGGTGSGSGSASAAPPSSSSKAAGGGRGGGGKNKGKGVAAAAPPPPPPPP RCQVEGCGADLSGIKNYYCRHKVCFMHSKAPRVVVAGLEQRFCQQCSRFHLLPEFDQG KRSCRRRLAGHNERRRRPQTPLASRYGRLAASVGEHRRFRSFTLDFSYPRVPSSVRNA WPAIQPGDRISGGIQWHRNVAPHGHSSAVAGYGANTYSGQGSSSSGPPVFAGPNLPPG GCLAGVGAATDSSCALSLLSTQPWDTTTHSAAASHNQAAAMSTTTSFDGNPVAPSAMA GSYMAPSPWTGSRGHEGGGRSVAHQLPHEVSLDEVHPGPSHHAHFSGELELALQGNGP APAPRIDPGSGSTFDQTSNTMDWSL</aaseq>

Gene Sequence

<dnaseqindica>3239..3909#3003..3136#124..572#ttccgtctctttcctctctcttctctctccccctctcctggaggagagagaggagaagaggagggggggccgcgccaagagccacgcgcgctacagtctccttcccacccgcgaccgcgagcaatggagatggccagtggaggaggcgccgccgccgccgccggcggcggagtaggcggcagcggcggcggtggtggtggaggggacgagcaccgccagctgcacggtctcaagttcggcaagaagatctacttcgaggacgccgccgcggcagcaggcggcggcggcactggcagtggcagtggcagcgcgagcgccgcgccgccgtcctcgtcttccaaggcggcgggtggtggacgcggcggagggggcaagaacaaggggaagggcgtggccgcggcggcgccaccgccgccgccgccgccgccgcggtgccaggtggaggggtgcggcgcggatctgagcgggatcaagaactactactgccgccacaaggtgtgcttcatgcattccaaggctccccgcgtcgtcgtcgccggcctcgagcagcgcttctgccagcagtgcagcaggtcactctctcactcacctcgccattgctgatgtcaccactgcttttgctttgctttgcttgctctccctcctctttcacctatctctcttgtttatttgcttcttgttcttgtttagtgctagtacatgtgttgttattgttgtgccgttttgtcttttgggttattgtgttgttgttactactcgttttactataggtttttaaggtttatgagcacggccaccacattagatgcactgtcaagtggtgtgtgtgggacctttcctgctaaaacaagctgatttcaactctctgaaacttcctgcatttcatctatttttatctttgattgtgttgggagtactacactagtagtgttaatattttgactggtgcttatgagatttttaagttggtaggttgatgaggaaaatactcctttatatggttgagtgatgtgacttgcctgtctgcctgcctgcctgccgctttgcataagattcctctgtgttagtaagagccactgtttatttgtactggtgcttactctacttagttaattagccattagctataaaattccgttgatgttgcaagcttagcaatggccacggtaagaatgggagagagaagttggctaaagctgttgctttgtagtttgtactatatatgtgtctttgtgttgcaagatatgcaactcctactatgctgtgacttgagctcaaggttttcagttatctatagatccttactactactgagcatactaccacttctgtatggtagcatatggtagcatagtccaagttccaacgcctcgccagttgttcataatctatactaccacttctgtgcatttgttacttttatttaatagtttgtctcattagctgacaagcatatgcctgttttgatatctgcccctcttgtaatagtctatggatagcttggactgtttgatgctttaattttttactagcaacacttagggcccctttgaaatggaggattagcaaaggaattttggaggattcattttcctaaggattttttcctatagagccctttgattcatagaaagaggataggaaaacttccgtaggattgcattcctatgatcaattccataggaaaataagcaagaggttagacctcttgtgaaactttcctttgttgagtgtatcttgtggtataatcaaagggctcttctctccatttcatgtgttttcaattcctgtaggattggaaaaacatacaacttcaattcctacgtttttcctattcctatgtttttcctatcctgcgtttcaaaggggcccttaaggatgaagggaagtaagagaaacatactagagaatatgtagtagtatttctacattccatatttgtagcactagcccacaaatatctttgccttgtacttacttcataccagttccccccttttcagagcaaaccaacaatttctgttgccttatatatctagtgtcttcgtactaatatatctgttccaaaatgtacctgtccaaattcatagctagaaatagctttatttaggacggaagtaataactgttgttagagacttggttcagacttttggttatgttgaggctactatcatttcctttacgggccaaattactacaaatgagaattcataaaaatgtcaagattttatgattgttgtagctttatttaggacggaggtagtaattgttgttagagacttggttcagacttttggttacgttgaagctactatcatttcctttatggtcaaattactaacaatgagtattcataaaaatgtcaagattttataattgagctgtgccagtgctaagtgtgtcactatctgatgccataatgcatcattataaaagccagatggaccattagcttttatgtgtaggacacctgccgtccaattagatggataaccatctagtgtttgtgtactgttattttaagcccgacatctcacaactccatgaatgattacagtcttcctttcacatggtgtccttttgttgtgttaggaatagcattttttatttatgggtgtaattatgaaaggcactaggagagttgctgctttatcttgatgggatttgtagtaataccatctttaggatgacaagaaatcttgttctgagttagcatgggctgccttttgacctgagctacggtttgctatgtttggcttgcatcatgcagatctattaggataataagcatataaaagttgcttgcattgtgcattgcttgttttaccttgattcatgtaggagtaatttgctcgccatgcctcgttttgctttctgagtcaacagccaaatttagatgatgtaccttctgttgcttcaaaaactcagtcactgcacagcagcagtggataggattcagaatcaatctatccatgattctctgttcacataatatgacaggttccacctgctgcctgaatttgaccaaggaaaacgcagctgccgcagacgccttgcaggtcataatgagcgccggaggaggccgcaaacccctttggcatcacgctacggtcgactagctgcatctgttggtggtatcatcagaggctcttgttttctttgcatcttgtgtgtttgttggtaactactggttgcattcgctgatgtgttgtttgttgcgattcttgatccagaagagcatcgcaggttcagaagctttacgttggatttctcctacccaagggttccaagcagcgtaaggaatgcatggccagcaattcaaccaggcgatcggatctccggtggtatccagtggcacaggaacgtagctcctcatggtcactctagtgcagtggcgggatatggtgccaacacatacagcggccaaggtagctcttcttcagggccaccggtgttcgctggcccaaatctccctccaggtggatgtctcgcaggggtcggtgccgccaccgactcgagctgtgctctctctcttctgtcaacccagccatgggatactactacccacagtgccgctgccagccacaaccaggctgcagccatgtccactaccaccagctttgatggcaatcctgtggcaccctccgccatggcgggtagctacatggcaccaagcccctggacaggttctcggggccatgagggtggtggtcggagcgtggcgcaccagctaccacatgaagtctcacttgatgaggtgcaccctggtcctagccatcatgcccacttctccggtgagcttgagcttgctctgcaggggaacggtccagccccagcaccacgcatcgatcctgggtccggcagcaccttcgaccaaaccagcaacacgatggattggtctctgtagaggctgttccagctgccatcgatctgtcgtcccgcaaggcgagtcatggaactgaagaacctcatgctgcctgcccttattttgtgttcaaattttcctttccagtatggaaaggaaattctaaggtgactggcgattaatctccctgtgatgaataataatgcgcgcccttgaactcaattaattgctgtgccgcatccatctatgtaactctccatgaatttttaagtatcagtgttaatgctgt</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0509600, RefSeq:Os08g0509600