Difference between revisions of "Os03g0706500"
(→References) |
(→References) |
||
| Line 33: | Line 33: | ||
==References== | ==References== | ||
<references> | <references> | ||
| − | <ref name="NATURE rice-1"> | + | <ref name="NATURE rice-1">Guo S, Xu Y, Liu H, et al. The interaction between OsMADS57 and OsTB1 modulates rice tillering via DWARF14[J]. Nature communications 2013; 4: 1566.</ref> |
| + | <ref name="水稻OsTB1基因的结构及其表达分析-2">Hu W, Zhang S, Zhao Z, Sun C, Zhao Y, Luo D. The Analysis of the Structure and Expression of OsTBl Gene in rice[J]. Journal of plant physiology and molecular biology 2002; 29(6): 507-14.</ref> | ||
| + | <ref name="ref3">Minakuchi K, Kameoka H, Yasuno N, et al. FINE CULM1 (FC1) works downstream of strigolactones to inhibit the outgrowth of axillary buds in rice[J]. Plant and cell physiology 2010; 51(7): 1127-35.</ref> | ||
| + | <ref name="ref4">Takeda T, Suwa Y, Suzuki M, et al. The OsTB1 gene negatively regulates lateral branching in rice[J]. The Plant Journal 2003; 33(3): 513-20</ref> | ||
| + | <ref name="李家洋nature12870"> Jiang L, Liu X, Xiong G, et al. DWARF 53 acts as a repressor of strigolactone signalling in rice[J]. Nature 2013.</ref> | ||
==Structured Information== | ==Structured Information== | ||
Revision as of 08:46, 13 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
The rice TB1 gene (OsTB1) was first identified based on its sequence similarity with maize TEOSINTE BRANCHED 1 (TB1) which is involved in lateral branching in maize. Both genes encode putative transcription factors carrying a basic helix-loop-helix type of DNA-binding motif, named the TCP domain[1]. The deduced amino acid sequence of the OsTB1 ORF comprises 388 amino acid residues that is a member of the TCP family of transcription factors[3]. Note that the in-frame stop codon was found two codons upstream of the deduced first methionine, suggesting that the methionine is used as an initiation codon. The DNA fragment also contains 1261-and 1198-bp 5 'and 3'-non-coding regions, respectively. The OsTB1 protein contains three significant sequence motifs, the SP, TCP and R domains. The R domain contains basic amino acid residues and is conserved in subpopulations of the TCP family. The SP domain contains a number of serine and proline residues, and is found in a limited number of members whose primary structures entirely match that of TB1. Although the precise molecular functions of these domains except for the TCP domain remain unknown, the close resemblance of the primary structures of OsTB1 and maize TB1 together with the entire sequences strongly suggests that the biological function of OsTB1 is similar to that of maize TB1. A series of genetic and reverse-genetic analyses thus conducted indicated that OsTB1 is a negative regulator for lateral branching in rice[2][3][1].
The OsMADS57 protein negatively regulates the expression of D14 functioning in strigolactone(SL) signalling to control tillering. This negative regulation by OsMADS57 is suppressed by interaction with OsTB1, leading to the balanced expression of D14 for tillering[2].
Expression
The expression of OsTB1 was detected in vegetative apical meristems, young roots and tillers of rice, and it seemed that there was weak expression in developed spikelets, but no expression in young leaves. The expression of OsTB1in tillers was stronger than in other tissues[4].
The total number of tillers is significantly reduced by the overexpression of OsTB1, but increased in an fc1 mutant containing a loss-of-function mutation of OsTB1. This strongly suggests that OsTB1 functions as a negative regulator for lateral branching in rice[3][1].An fc1 mutant strain, M56, exhibited a bushy morphology as to enhanced lateral branching. Quantitative analysis showed that the fc1 mutant generated a threefold higher number of tillers than the wild-type strain did.Sequencing analysis of the PCR amplified OsTB1 ORF from the fc1 genome revealed one nucleotide deletion in OsTB1. The C-base at the 327th nucleotide in the ORF was deleted in the fc1 mutant, resulting in a frame shift of the ORF generating a stop codon just downstream of the mutation[1].
Evolution
The OsTB1 shows 70%, 41%, 32% and 31% similarity with TB1, CYC, PCF1 and PCF2, respectively. The conserved TCP region of OsTB1 has 93%, 80%,49% and 46% similarity with TB1, CYC,PCF1 and PCF2,respectively. Moreover , the R conserved regions among TB1,CYC, OsTB1 are nearly identical[4].
Knowledge Extension
Strigolactones (SLs) are a group of newly identified plant hormones that control plant shoot branching[5]. SL signaling requires the hormone-dependent interaction of DWARF14 (D14) which is regulated by the interaction of OsMADS57 with OsTB1[2].
Labs working on this gene
- National Laboratory of Plant Molecular Genetics,Institute of Plant Physiology and Ecology,Chinese Academy of Sciences, China
- The Key Laboratory of Plant Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, China
- Graduate School of Agriculture and Life Sciences, University of Tokyo, Tokyo 113-8657 ,Japan
- Bioscience Center, Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya 464-8601, Japan
References
<references> [2] [4] [3] [1] [5]
Structured Information
| Gene Name |
Os03g0706500 |
|---|---|
| Description |
TCP transcription factor family protein |
| Version |
NM_001057563.1 GI:115454854 GeneID:4333856 |
| Length |
1935 bp |
| Definition |
Oryza sativa Japonica Group Os03g0706500, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 3:29188933..29190867 |
| Sequence Coding Region |
29189438..29190604 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008396:29188933..29190867 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008396:29188933..29190867 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgcttcctttcttcgattccccaagccccatggacataccgctttaccaacagcttcagctcacccctccctctccaaagcccgaccaccaccaccaccaccattccaccttcttctactaccaccaccacccacctccctccccttccttcccctccttcccctcccccgccgccgccacgatcgcctcgccgtcgccggccatgcaccccttcatggacttggagttggagccgcatgggcagcagctggcggcggcggaggaggacggggcaggcgggcaaggcgtcgacgccggggtgcccttcggcgtcgacggagcggcggcggccgcggcggcgaggaaggaccggcacagcaagataagcaccgccggcgggatgagggaccggcggatgcggctgtccctcgacgtcgcccgcaagttcttcgcgctccaggacatgctcggcttcgacaaggccagcaagacggtgcaatggctcctcaacatgtccaaggccgccatccgggagatcatgagcgacgacgcctcctccgtctgcgaggaggacggctccagcagcctctccgtcgacggcaagcagcagcagcacagcaacccggcggatcggggcggcggcgccggggaccacaagggcgccgctcacggccacagcgacgggaagaagccggccaagccgagaagggcagcggccaacccgaagccaccgcggcggctggccaatgcgcaccccgtccccgacaaggagtcgcgcgccaaggcgagggagcgggcgcgggagcggaccaaggagaagaaccggatgcggtgggtcaccctcgcctcggcaatcagcgtcgaggcggccaccgcggcggcggccgcgggggaggacaagtcgccgacgagccccagcaacaacctgaaccactcatcgtccaccaatcttgtgagcaccgaattggaggacggctcctcgtcaacgcgccacaacggcgtcggcgtcagcggcggccggatgcaagaaatctcggcggctagcgaggcgagcgacgtgatcatggcgttcgccaacggcggcgcgtacggcgacagcggcagctactacctgcagcagcagcatcagcaggatcagtgggagctcggcggcgtcgtctacgccaattcgcggcactactgctga</cdnaseq> |
| Protein Sequence |
<aaseq>MLPFFDSPSPMDIPLYQQLQLTPPSPKPDHHHHHHSTFFYYHHH PPPSPSFPSFPSPAAATIASPSPAMHPFMDLELEPHGQQLAAAEEDGAGGQGVDAGVP FGVDGAAAAAAARKDRHSKISTAGGMRDRRMRLSLDVARKFFALQDMLGFDKASKTVQ WLLNMSKAAIREIMSDDASSVCEEDGSSSLSVDGKQQQHSNPADRGGGAGDHKGAAHG HSDGKKPAKPRRAAANPKPPRRLANAHPVPDKESRAKARERARERTKEKNRMRWVTLA SAISVEAATAAAAAGEDKSPTSPSNNLNHSSSTNLVSTELEDGSSSTRHNGVGVSGGR MQEISAASEASDVIMAFANGGAYGDSGSYYLQQQHQQDQWELGGVVYANSRHYC</aaseq> |
| Gene Sequence |
<dnaseqindica>506..1672#aagatggcaacaccctgatctctagcttagctgcagaggggagaggaacctcacatccaaactcctagctacaacttgtactagcatcctaagcaaccaagcacaaccaaagcaagcaagcacgaacaattctttcttcctctctacctctagctgctgcctgcctcctaatcctcctacccaccactccacatgagcccatgctgtgtgcctgtgtctgtgtgtgtgttctactcctaccatgagagaagagaccaagcatcaaccaagctagctagctcgtcctctcctcgatctctacttctctctcccacacaagctgagcgcccaggtaggctgcctgctaggtctcgtgcatggccggacacatctgatcatagcccactacggcactattccccccttccgcctcgcacgctgagaggtggccggagagggagggaggccagcgagcagcagtagcagcagcaacgcggctaggagtaaggagtcccatcagtaaagcatgcttcctttcttcgattccccaagccccatggacataccgctttaccaacagcttcagctcacccctccctctccaaagcccgaccaccaccaccaccaccattccaccttcttctactaccaccaccacccacctccctccccttccttcccctccttcccctcccccgccgccgccacgatcgcctcgccgtcgccggccatgcaccccttcatggacttggagttggagccgcatgggcagcagctggcggcggcggaggaggacggggcaggcgggcaaggcgtcgacgccggggtgcccttcggcgtcgacggagcggcggcggccgcggcggcgaggaaggaccggcacagcaagataagcaccgccggcgggatgagggaccggcggatgcggctgtccctcgacgtcgcccgcaagttcttcgcgctccaggacatgctcggcttcgacaaggccagcaagacggtgcaatggctcctcaacatgtccaaggccgccatccgggagatcatgagcgacgacgcctcctccgtctgcgaggaggacggctccagcagcctctccgtcgacggcaagcagcagcagcacagcaacccggcggatcggggcggcggcgccggggaccacaagggcgccgctcacggccacagcgacgggaagaagccggccaagccgagaagggcagcggccaacccgaagccaccgcggcggctggccaatgcgcaccccgtccccgacaaggagtcgcgcgccaaggcgagggagcgggcgcgggagcggaccaaggagaagaaccggatgcggtgggtcaccctcgcctcggcaatcagcgtcgaggcggccaccgcggcggcggccgcgggggaggacaagtcgccgacgagccccagcaacaacctgaaccactcatcgtccaccaatcttgtgagcaccgaattggaggacggctcctcgtcaacgcgccacaacggcgtcggcgtcagcggcggccggatgcaagaaatctcggcggctagcgaggcgagcgacgtgatcatggcgttcgccaacggcggcgcgtacggcgacagcggcagctactacctgcagcagcagcatcagcaggatcagtgggagctcggcggcgtcgtctacgccaattcgcggcactactgctgatgtgatcatccatccacacacgaacgaacgaacgaacggtacggcactaagatcgaactcctgcagctacataattatcctttgcttctcaagagtaataattcttgacgtgttaattaatccgggtgtgtattaattccctctttattattttttctcgcgtttatccggagttgactgtggtgaagacgaactttggtttggtcatcgcatggtgtgcattgcatatatagctagcactatcgtctgatcgatgattcatc</dnaseqindica> |
| External Link(s) |
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 Takeda T, Suwa Y, Suzuki M, et al. The OsTB1 gene negatively regulates lateral branching in rice[J]. The Plant Journal 2003; 33(3): 513-20
- ↑ 2.0 2.1 2.2 2.3 2.4 Guo S, Xu Y, Liu H, et al. The interaction between OsMADS57 and OsTB1 modulates rice tillering via DWARF14[J]. Nature communications 2013; 4: 1566.
- ↑ 3.0 3.1 3.2 3.3 Minakuchi K, Kameoka H, Yasuno N, et al. FINE CULM1 (FC1) works downstream of strigolactones to inhibit the outgrowth of axillary buds in rice[J]. Plant and cell physiology 2010; 51(7): 1127-35.
- ↑ 4.0 4.1 4.2 Hu W, Zhang S, Zhao Z, Sun C, Zhao Y, Luo D. The Analysis of the Structure and Expression of OsTBl Gene in rice[J]. Journal of plant physiology and molecular biology 2002; 29(6): 507-14.
- ↑ 5.0 5.1 Jiang L, Liu X, Xiong G, et al. DWARF 53 acts as a repressor of strigolactone signalling in rice[J]. Nature 2013.
