Difference between revisions of "Os10g0445400"

From RiceWiki
Jump to: navigation, search
Line 5: Line 5:
 
===Function===
 
===Function===
  
OsHCI1 (Oryza sativa Heat and Cold Induced 1) encodes a 246-amino acid protein with a predicted molecular mass of 28.8kDa and harbours a single RING-HC domain in its C-terminal region. It is a rice RING domain E3 ligase, which is highly induced under heat and cold stress conditions. OsHCI1 dynamically moves from the cytoplasm to the nucleus along cytoskeletal tracts under heat shock conditions. OsHCI1 interacts with six substrate proteins and mediates subcellular trafficking of nuclear proteins to the cytoplasm via monoubiquitination. Arabidopsis overexpressing OsHCI1-EYFP exhibits a heat-tolerant phenotype, suggesting an important role of this protein in the regulation of heat-generated signals in plants.
+
OsHCI1 (Oryza sativa Heat and Cold Induced 1) encodes a 246-amino acid protein with a predicted molecular mass of 28.8kDa and harbours a single RING-HC domain in its C-terminal region. It is a rice RING domain E3 ligase, which is highly induced under heat and cold stress conditions.  
 +
OsHCI1 dynamically moves from the cytoplasm to the nucleus along cytoskeletal tracts under heat shock conditions.  
 +
OsHCI1 interacts with six substrate proteins and mediates subcellular trafficking of nuclear proteins to the cytoplasm via monoubiquitination.  
 +
Arabidopsis overexpressing OsHCI1-EYFP exhibits a heat-tolerant phenotype, suggesting an important role of this protein in the regulation of heat-generated signals in plants.
 
===Expression===
 
===Expression===
 
Please input expression information here.
 
Please input expression information here.

Revision as of 12:24, 13 May 2014

Please input one-sentence summary here.

Annotated Information

OsHCI1 encodes a RING finger E3 ligases, which is specifically induced by heat and cold stress. OsHCI1 can drive nuclear export of multiple protein substrate, and the heterologous overexpression of Arabidopsis can enhance acquired-thermotolerance.

Function

OsHCI1 (Oryza sativa Heat and Cold Induced 1) encodes a 246-amino acid protein with a predicted molecular mass of 28.8kDa and harbours a single RING-HC domain in its C-terminal region. It is a rice RING domain E3 ligase, which is highly induced under heat and cold stress conditions. OsHCI1 dynamically moves from the cytoplasm to the nucleus along cytoskeletal tracts under heat shock conditions. OsHCI1 interacts with six substrate proteins and mediates subcellular trafficking of nuclear proteins to the cytoplasm via monoubiquitination. Arabidopsis overexpressing OsHCI1-EYFP exhibits a heat-tolerant phenotype, suggesting an important role of this protein in the regulation of heat-generated signals in plants.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

1.Department of Applied Plant Sciences, Kangwon National University, Chuncheon 200-713, Korea.

References

Please input cited references here.

Structured Information

Gene Name

Os10g0445400

Description

Zinc finger, RING-type domain containing protein

Version

NM_001071244.2 GI:297610563 GeneID:4348743

Length

2212 bp

Definition

Oryza sativa Japonica Group Os10g0445400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 10

Location

Chromosome 10:16541690..16543901

Sequence Coding Region

16541849..16542062,16542867..16543089,16543187..16543253,16543374..16543610

Expression

GEO Profiles:Os10g0445400

Genome Context

<gbrowseImage1> name=NC_008403:16541690..16543901 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:16541690..16543901 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgagctgtgagttcttcctcccttcgccggtcgcggctcgtggacggtggtggtggtggggggtttgcgtgtggttcatctctctcttttgcagggcgtcggagttcttgcgggattacgacggggcggtgatccagatgcggatggcgtacagcgccgtcgcgcacttcctcgtgcagtggatcgactgcaagctcgccggcgcgctcggcctcctcaagatcatgatctacaaggtgtacgccgatggcaccacggctctgccggagtgggagagggaggccagcatcaggcaattctacggtgtcatcttcccgtcgctgctccagctgccgagtgggataactgaattggacgacaggaagcagaggaggctgtgccttcagaagttcaggaaggtggaggagagggtctcggaggtggatttggagagggagctcgagtgcggcatctgcctcgaggtgaatgccaagattgtgctgcccgattgcgcgcactcgctgtgcatgagatgcttcgaggattggaacaccaaatcaaagtcgtgccccttctgccgcgcctgcctcaagaaggtgaatccgagcagcctgtggttgtacaccgacgaccgcgatgttgtggatatggatacgttgactagggagaacattaggcgcctgttcatgttcataagtaagcttccacttgtagtgctccatgtggttgaccttgacatttacgagtaccgtatcaagtga</cdnaseq>

Protein Sequence

<aaseq>MSCEFFLPSPVAARGRWWWWGVCVWFISLFCRASEFLRDYDGAV IQMRMAYSAVAHFLVQWIDCKLAGALGLLKIMIYKVYADGTTALPEWEREASIRQFYG VIFPSLLQLPSGITELDDRKQRRLCLQKFRKVEERVSEVDLERELECGICLEVNAKIV LPDCAHSLCMRCFEDWNTKSKSCPFCRACLKKVNPSSLWLYTDDRDVVDMDTLTRENI RRLFMFISKLPLVVLHVVDLDIYEYRIK</aaseq>

Gene Sequence

<dnaseqindica>1840..2053#813..1035#649..715#292..528#ggggctcggattagagttggactcggcaacgcgacgagcaccaaaagcgagggaagaaaaccaatccgaatccggagagagaagcgcaggaggcaaaatccactccaattcaacccaatcacccgcggcgagccgagcgggcggcggagcacgacgacgacgaggtttaggtaggggttcttggcttgtcggcgtcggcggcggcggcggcggaggaggaggaggagtcagcgatgcggaggaggttccaggactccgtcaaggccctcgaggccgacatcgagcacgccaatgagctgtgagttcttcctcccttcgccggtcgcggctcgtggacggtggtggtggtggggggtttgcgtgtggttcatctctctcttttgcagggcgtcggagttcttgcgggattacgacggggcggtgatccagatgcggatggcgtacagcgccgtcgcgcacttcctcgtgcagtggatcgactgcaagctcgccggcgcgctcggcctcctcaagatcatgatctacaaggtctcgcccacacccccgcgccatcgccaattcgcagctgatttctcaccggctgggtaactaactaactaactaactaactaactaatcaccgggttcttgctggtaaatcgaatgcaggtgtacgccgatggcaccacggctctgccggagtgggagagggaggccagcatcaggcaattctacggtactactactcaatcgcaaccatctcctaacaacaagaacacgagcgattcaatttcatggttgtgatttctcaaattttttttgggtcgctgcaggtgtcatcttcccgtcgctgctccagctgccgagtgggataactgaattggacgacaggaagcagaggaggctgtgccttcagaagttcaggaaggtggaggagagggtctcggaggtggatttggagagggagctcgagtgcggcatctgcctcgaggtgaatgccaagattgtgctgcccgattgcgcgcactcgctgtgcatgagatgcttcgaggattggtaatttgccctcctccttcccctttaatttcccctctccttacattttcgcgcatgcgccaacacaaacatagagatattaggtactatcaattgttcatgttagaatcaaatatagctgttgcgtgctctaggagacaaaatttcgtttacctgaatgtggtgttcaagaaagagagaaaaagattacctttgccatatattggctggttgtgttcctcaggatgtaaagtcagttgtaaatctcctgcacttctgatagagtaccacaatgccctctccacagagtctttaaccatcttcatgcatcaagatgtagtccatccaatcaaacctgcatccagaatgactttatttataactgcagcaaacattctattgaactatgtcctgctcttgagcaggtaataacttattgatgtaaaagaagtaggcaaatagtcacaaaatgaactatatcatagatcggttgcatgatgctcctccaaaatacaaacctctgtatctggtaacaattctcaccttggttgaaggttacacacgcgcacacacagtctttgcatactctcttatgctgttagaaaactatgttgttctcagttcattgtatggttgacttcactttccttatagtcaatcctaagttgagagtgaatcattaaccactccttgtcagcaagcacaacaagatctgcaaccttgtccgtactcttcctacttgccgaggcgttcacttcgtctgatgcatgaatctgatcgaattccgtgggccatttaacgaaatttggcttgtcacatatgcaggaacaccaaatcaaagtcgtgccccttctgccgcgcctgcctcaagaaggtgaatccgagcagcctgtggttgtacaccgacgaccgcgatgttgtggatatggatacgttgactagggagaacattaggcgcctgttcatgttcataagtaagcttccacttgtagtgctccatgtggttgaccttgacatttacgagtaccgtatcaagtgaaactgtactcttttgttcataccggtgggtctctgtacatatcaaattcatcggtgctgatctgtgatagctcaacctgaggctgcaaattagcagagttgtttgtagctcaacgagttgataatatttttgtgaaaagaagatgctgaagtgtactcc</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0445400, RefSeq:Os10g0445400