Difference between revisions of "Os06g0597000"
(→Annotated Information) |
(→Annotated Information) |
||
| Line 7: | Line 7: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | This gene, ''OsIAA23'', is a mutation of ''Aux/IAA'' gene in rice. The mutant is characterized by a loss of QC identity during postembryonic development, and the displayed defects result from a stabilizing mutation in domain II of OsIAA23 (Os06g39590). | + | This gene, ''OsIAA23'', is a mutation of ''Aux/IAA'' gene in rice. The mutant is characterized by a loss of QC identity during postembryonic development, and the displayed defects result from a stabilizing mutation in domain II of OsIAA23 (Os06g39590). |
(1)Characterization of the mutant is show in '''Figure 1'''. | (1)Characterization of the mutant is show in '''Figure 1'''. | ||
(2) Cloning of the ''OsIAA23'' gene | (2) Cloning of the ''OsIAA23'' gene | ||
| Line 22: | Line 22: | ||
===Evolution=== | ===Evolution=== | ||
Aux/IAA and auxin response factor (ARF) are two important families that have been well recognized for their roles in auxin-mediated responses. Aux/IAA proteins are short-lived transcriptional regulators that mediate the auxin responses through interaction with ARF transcription factors. There are two members of Aux/IAA family in rice named ''OsIAA1'' and ''OsIAA23''. | Aux/IAA and auxin response factor (ARF) are two important families that have been well recognized for their roles in auxin-mediated responses. Aux/IAA proteins are short-lived transcriptional regulators that mediate the auxin responses through interaction with ARF transcription factors. There are two members of Aux/IAA family in rice named ''OsIAA1'' and ''OsIAA23''. | ||
| − | |||
| − | |||
==Labs working on this gene== | ==Labs working on this gene== | ||
Revision as of 14:28, 13 May 2014
Please input one-sentence summary here.
OsIAA23, an Aux/IAA gene in rice, which stabilizing mutation exhibited defects in postembryonic maintenance of the quiescent center (QC) that caused the disintegration of the root cap and termination of root growth.
OsIAA23, an Aux/IAA gene in rice, which stabilizing mutation exhibited defects in postembryonic maintenance of the quiescent center (QC) that caused the disintegration of the root cap and termination of root growth.
Contents
Annotated Information
Function
This gene, OsIAA23, is a mutation of Aux/IAA gene in rice. The mutant is characterized by a loss of QC identity during postembryonic development, and the displayed defects result from a stabilizing mutation in domain II of OsIAA23 (Os06g39590).
(1)Characterization of the mutant is show in Figure 1. (2) Cloning of the OsIAA23 gene
Heterozygous Osiaa23 (japonica) was crossed with Kasalath (indica). Approximately half of the F1 population that exhibited the heterozygous mutant phenotype was selected and self-pollinated. The derived F2 population was used to map OsIAA23.
The OsIAA23 gene, sequenced from homozygous mutant genomic DNA, was found to contain a G to A base pair substitution causing a glycine (G) to glutamate (E) change (Gly64Glu) in domain II of OsIAA23 (Figure 2). These results confirm that the root tissue defects in the mutant are caused by the point mutation in domain II of OsIAA23. (3) Response to auxin is reduced in Osiaa23
To investigate the auxin response of the Osiaa23 mutant,WT and Osiaa23 mutants were treated with a-naphthalene acetic acid (NAA). These results indicated a reduced sensitivity to auxin in the Osiaa23 mutant (Figure 3).
(4) Reduction of auxin signaling mediated by OsIAA23 is important for crown root primordia development. (5) OsIAA23 does not act only in the QC, but auxin signaling mediated by OsIAA23 in the QC plays a unique role in QC maintenance.
Expression
OsIAA23 was found to be constitutively expressed in all of the examined tissues, although a lower abundance was observed in the embryo (Figure 4).
Evolution
Aux/IAA and auxin response factor (ARF) are two important families that have been well recognized for their roles in auxin-mediated responses. Aux/IAA proteins are short-lived transcriptional regulators that mediate the auxin responses through interaction with ARF transcription factors. There are two members of Aux/IAA family in rice named OsIAA1 and OsIAA23.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os06g0597000 |
|---|---|
| Description |
Similar to Auxin responsive protein IAA-Re |
| Version |
NM_001064521.1 GI:115468773 GeneID:4341432 |
| Length |
1519 bp |
| Definition |
Oryza sativa Japonica Group Os06g0597000, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:24378976..24380494 |
| Sequence Coding Region |
24379095..24379270,24379356..24379676,24379766..24379827,24379946..24379968 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008399:24378976..24380494 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008399:24378976..24380494 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgtcgacgagctccggcgccgactcgtccccgcccgtctcgggcctcgactacgacgacaccgccctcaccctcgccctccccggctcctcctcctcctcctcctccaccgccgaccccgaacgcaagcgcgccgcccacgccgaccacgccgacgccaagccgccttccccaaaggcgcgggcggtggggtggccgccggtgagggcgtacaggcggaacgcgctgcgggaggactccgcgagggcgaagctggtcaaggtggccgtggacggcgcgccgtacctgcgcaaggtggacctcgcggcgcacgccggctacgcgcccctcctccgcgcgctccacggcatgttcgcctcctgcctcgccgtccgcggcggcggcggcggcgacggcgagggtacaaagctcgtcgacttggtcaccggcgccgagtacgtgcccacctacgaggacaaggacggcgactggatgctcgtcggcgacgtcccctggaagatgttcgtcgagtcctgcaagcggatccgtctcatgaagagctccgaggccgtcaacttatcgccaagacgatcatccagataa</cdnaseq> |
| Protein Sequence |
<aaseq>MSTSSGADSSPPVSGLDYDDTALTLALPGSSSSSSSTADPERKR AAHADHADAKPPSPKARAVGWPPVRAYRRNALREDSARAKLVKVAVDGAPYLRKVDLA AHAGYAPLLRALHGMFASCLAVRGGGGGDGEGTKLVDLVTGAEYVPTYEDKDGDWMLV GDVPWKMFVESCKRIRLMKSSEAVNLSPRRSSR</aaseq> |
| Gene Sequence |
<dnaseqindica>120..295#381..701#791..852#971..993#accaccacacccctcgtctccgcaaactcgacgcgccactcgacagcgaccccgcagccgatccatcccgccgccgaagcagcagcaaccgccacggtgcgccgccgccgccggtaccgatgtcgacgagctccggcgccgactcgtccccgcccgtctcgggcctcgactacgacgacaccgccctcaccctcgccctccccggctcctcctcctcctcctcctccaccgccgaccccgaacgcaagcgcgccgcccacgccgaccacgccgacgccaagccgccttccccaaagtacgtatagcttatgctctctttatggagattcctacgttcccgcgggtttctgacctggcgatcgatcgatgcgtgtgcgcagggcgcgggcggtggggtggccgccggtgagggcgtacaggcggaacgcgctgcgggaggactccgcgagggcgaagctggtcaaggtggccgtggacggcgcgccgtacctgcgcaaggtggacctcgcggcgcacgccggctacgcgcccctcctccgcgcgctccacggcatgttcgcctcctgcctcgccgtccgcggcggcggcggcggcgacggcgagggtacaaagctcgtcgacttggtcaccggcgccgagtacgtgcccacctacgaggacaaggacggcgactggatgctcgtcggcgacgtcccctggaagtaagcaacgcgtgtacacatctcaatcagttcttgccgattaattcaccgaaatcaaatgcaaaatctgatccgatcaatcaacacaggatgttcgtcgagtcctgcaagcggatccgtctcatgaagagctccgaggccgtcaacttatgtaagaacttgcgatccaatccactataataatccaataacattacattaccaactatactaattactgcaacgatcgatgagtgaatgacatttcgattctgaattttttgatgcagcgccaagacgatcatccagataatcgatcctaccacacgcaacgatgcaatgccgcaattgatctgtctgtctgtctgtctgtctgaattagttcgtctgaaagtgtgtgcaatggaagaggcttggctgtacaggtcctccatgcatatgtacctataccgtagtaggatcagtgatcgatgagccaaattggtgtgtgtactgtacaggccacaagaacgaaaatatcctctctctttaattcaggtgtgctccctgctgccggatcacggccggcccggtttggtttttggacgacggcggcgaggatcgatccaagggaggcgccgccacgccgccgcggcggtgtactttaattttcaagttgtcagctactttctgtaatttgtttcatgatggttcggtttcctgtgacagccagcacttttgttgtatgtcaaatgcaatgtatacatgatataccggttgttatcgttgttgttgctgttgttgactttgttctgtccattgatgcattgcaaggtcaaatataggagcacaataatctg</dnaseqindica> |
| External Link(s) |