Difference between revisions of "Os06g0597000"
| Line 1: | Line 1: | ||
| − | + | ''OsIAA23'', an ''Aux/IAA'' gene in rice, which stabilizing mutation exhibited defects in postembryonic maintenance of the quiescent center (QC) that caused the disintegration of the root cap and termination of root growth. | |
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | ||
| + | This gene, ''OsIAA23'', is a mutation of ''Aux/IAA'' gene in rice. The mutant is characterized by a loss of QC identity during postembryonic development, and the displayed defects result from a stabilizing mutation in domain II of OsIAA23 (Os06g39590). | ||
(1)Characterization of the mutant is show in '''Figure 1'''. | (1)Characterization of the mutant is show in '''Figure 1'''. | ||
(2) Cloning of the ''OsIAA23'' gene | (2) Cloning of the ''OsIAA23'' gene | ||
| − | + | Heterozygous ''Osiaa23'' (''japonica'') was crossed with Kasalath (''indica''). Approximately half of the F1 population that exhibited the heterozygous mutant phenotype was selected and self-pollinated. The derived F2 population was used to map ''OsIAA23''. | |
The ''OsIAA23'' gene, sequenced from homozygous mutant genomic DNA, was found to contain a G to A base pair substitution causing a glycine (G) to glutamate (E) change (Gly64Glu) in domain II of ''OsIAA23'' '''(Figure 2)'''. These results confirm that the root tissue defects in the mutant are caused by the point mutation in domain II of ''OsIAA23''. | The ''OsIAA23'' gene, sequenced from homozygous mutant genomic DNA, was found to contain a G to A base pair substitution causing a glycine (G) to glutamate (E) change (Gly64Glu) in domain II of ''OsIAA23'' '''(Figure 2)'''. These results confirm that the root tissue defects in the mutant are caused by the point mutation in domain II of ''OsIAA23''. | ||
(3) Response to auxin is reduced in ''Osiaa23'' | (3) Response to auxin is reduced in ''Osiaa23'' | ||
| − | + | To investigate the auxin response of the ''Osiaa23'' mutant,WT and ''Osiaa23'' mutants were treated with a-naphthalene acetic acid (NAA). These results indicated a reduced sensitivity to auxin in the ''Osiaa23'' mutant '''(Figure 3)'''. | |
(4) Reduction of auxin signaling mediated by ''OsIAA23'' is important for crown root primordia development. | (4) Reduction of auxin signaling mediated by ''OsIAA23'' is important for crown root primordia development. | ||
| − | (5) ''OsIAA23'' does not act only in the QC, but auxin signaling mediated by ''OsIAA23'' in the QC plays a unique role in QC maintenance. | + | (5) ''OsIAA23'' does not act only in the QC, but auxin signaling mediated by ''OsIAA23'' in the QC plays a unique role in QC maintenance[1]. |
===Expression=== | ===Expression=== | ||
| − | + | ||
| + | ''OsIAA23'' was found to be constitutively expressed in all of the examined tissues, although a lower abundance was observed in the embryo '''(Figure 4)'''. | ||
===Evolution=== | ===Evolution=== | ||
| − | + | Aux/IAA and auxin response factor (ARF) are two important families that have been well recognized for their roles in auxin-mediated responses. Aux/IAA proteins are short-lived transcriptional regulators that mediate the auxin responses through interaction with ARF transcription factors[2].There are 31 members of Aux/IAA family genes in rice(''OsIAA1''- ''OsIAA31''). The first rice ''Aux/IAA'' gene (LOC_Os03g53150) was reported by Thakur et al[3] and they demonstrated that the ''Aux/IAA'' gene appears to have same function as the homology genes in ''Arabidopsis''(Figure 4)[4]. | |
==Labs working on this gene== | ==Labs working on this gene== | ||
| − | + | 1. State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058, China; | |
| + | 2. National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China; | ||
| + | 3. Interdisciplinary Centre for Plant Genomics and Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez Road, New Delhi, 110021, India. | ||
==References== | ==References== | ||
| − | + | ||
| + | [1] Ni Jun, Wang Gaohang, Zhu Zhenxing et.al . OsIAA23-mediated auxin signaling defines postembryonic maintenance of QC in rice.''The Plant Journal''(2011) 38, 433–442; | ||
| + | [2] Yaling Song,Jun You,Lizhong Xiong. Characterization of OsIAA1 gene, a member of rice Aux/IAA family involved in auxin and brassinosteroid hormone responses and plant morphogenesis. ''Plant Mol Biol''(2009) 70:297–309; | ||
| + | [3] Thakur JK, Tyagi AK, Khurana JP.OsIAA1, an Aux/IAA cDNA from rice, and changes in its expression as influenced by auxin and light.''DNA Res''(2001) 8:193–203 | ||
| + | [4] Mukesh Jain, Navneet Kaur, Rohini Garg et.al. Structure and expression analysis of early auxin-responsive ''Aux/IAA'' gene family in rice (Oryza sativa).''Funct Integr Genomics''(2006) 6: 47–59. | ||
==Structured Information== | ==Structured Information== | ||
| Line 34: | Line 42: | ||
Definition = Oryza sativa Japonica Group Os06g0597000, complete gene.| | Definition = Oryza sativa Japonica Group Os06g0597000, complete gene.| | ||
Source = Oryza sativa Japonica Group | Source = Oryza sativa Japonica Group | ||
| − | + | ||
ORGANISM Oryza sativa Japonica Group | ORGANISM Oryza sativa Japonica Group | ||
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; | ||
Revision as of 15:14, 13 May 2014
OsIAA23, an Aux/IAA gene in rice, which stabilizing mutation exhibited defects in postembryonic maintenance of the quiescent center (QC) that caused the disintegration of the root cap and termination of root growth.
Contents
Annotated Information
Function
This gene, OsIAA23, is a mutation of Aux/IAA gene in rice. The mutant is characterized by a loss of QC identity during postembryonic development, and the displayed defects result from a stabilizing mutation in domain II of OsIAA23 (Os06g39590). (1)Characterization of the mutant is show in Figure 1. (2) Cloning of the OsIAA23 gene Heterozygous Osiaa23 (japonica) was crossed with Kasalath (indica). Approximately half of the F1 population that exhibited the heterozygous mutant phenotype was selected and self-pollinated. The derived F2 population was used to map OsIAA23. The OsIAA23 gene, sequenced from homozygous mutant genomic DNA, was found to contain a G to A base pair substitution causing a glycine (G) to glutamate (E) change (Gly64Glu) in domain II of OsIAA23 (Figure 2). These results confirm that the root tissue defects in the mutant are caused by the point mutation in domain II of OsIAA23. (3) Response to auxin is reduced in Osiaa23 To investigate the auxin response of the Osiaa23 mutant,WT and Osiaa23 mutants were treated with a-naphthalene acetic acid (NAA). These results indicated a reduced sensitivity to auxin in the Osiaa23 mutant (Figure 3). (4) Reduction of auxin signaling mediated by OsIAA23 is important for crown root primordia development. (5) OsIAA23 does not act only in the QC, but auxin signaling mediated by OsIAA23 in the QC plays a unique role in QC maintenance[1].
Expression
OsIAA23 was found to be constitutively expressed in all of the examined tissues, although a lower abundance was observed in the embryo (Figure 4).
Evolution
Aux/IAA and auxin response factor (ARF) are two important families that have been well recognized for their roles in auxin-mediated responses. Aux/IAA proteins are short-lived transcriptional regulators that mediate the auxin responses through interaction with ARF transcription factors[2].There are 31 members of Aux/IAA family genes in rice(OsIAA1- OsIAA31). The first rice Aux/IAA gene (LOC_Os03g53150) was reported by Thakur et al[3] and they demonstrated that the Aux/IAA gene appears to have same function as the homology genes in Arabidopsis(Figure 4)[4].
Labs working on this gene
1. State Key Laboratory of Plant Physiology and Biochemistry, College of Life Science, Zhejiang University, Hangzhou 310058, China; 2. National Center of Plant Gene Research (Wuhan), National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 430070, China; 3. Interdisciplinary Centre for Plant Genomics and Department of Plant Molecular Biology, University of Delhi South Campus, Benito Juarez Road, New Delhi, 110021, India.
References
[1] Ni Jun, Wang Gaohang, Zhu Zhenxing et.al . OsIAA23-mediated auxin signaling defines postembryonic maintenance of QC in rice.The Plant Journal(2011) 38, 433–442; [2] Yaling Song,Jun You,Lizhong Xiong. Characterization of OsIAA1 gene, a member of rice Aux/IAA family involved in auxin and brassinosteroid hormone responses and plant morphogenesis. Plant Mol Biol(2009) 70:297–309; [3] Thakur JK, Tyagi AK, Khurana JP.OsIAA1, an Aux/IAA cDNA from rice, and changes in its expression as influenced by auxin and light.DNA Res(2001) 8:193–203 [4] Mukesh Jain, Navneet Kaur, Rohini Garg et.al. Structure and expression analysis of early auxin-responsive Aux/IAA gene family in rice (Oryza sativa).Funct Integr Genomics(2006) 6: 47–59.
Structured Information
| Gene Name |
Os06g0597000 |
|---|---|
| Description |
Similar to Auxin responsive protein IAA-Re |
| Version |
NM_001064521.1 GI:115468773 GeneID:4341432 |
| Length |
1519 bp |
| Definition |
Oryza sativa Japonica Group Os06g0597000, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:24378976..24380494 |
| Sequence Coding Region |
24379095..24379270,24379356..24379676,24379766..24379827,24379946..24379968 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008399:24378976..24380494 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008399:24378976..24380494 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgtcgacgagctccggcgccgactcgtccccgcccgtctcgggcctcgactacgacgacaccgccctcaccctcgccctccccggctcctcctcctcctcctcctccaccgccgaccccgaacgcaagcgcgccgcccacgccgaccacgccgacgccaagccgccttccccaaaggcgcgggcggtggggtggccgccggtgagggcgtacaggcggaacgcgctgcgggaggactccgcgagggcgaagctggtcaaggtggccgtggacggcgcgccgtacctgcgcaaggtggacctcgcggcgcacgccggctacgcgcccctcctccgcgcgctccacggcatgttcgcctcctgcctcgccgtccgcggcggcggcggcggcgacggcgagggtacaaagctcgtcgacttggtcaccggcgccgagtacgtgcccacctacgaggacaaggacggcgactggatgctcgtcggcgacgtcccctggaagatgttcgtcgagtcctgcaagcggatccgtctcatgaagagctccgaggccgtcaacttatcgccaagacgatcatccagataa</cdnaseq> |
| Protein Sequence |
<aaseq>MSTSSGADSSPPVSGLDYDDTALTLALPGSSSSSSSTADPERKR AAHADHADAKPPSPKARAVGWPPVRAYRRNALREDSARAKLVKVAVDGAPYLRKVDLA AHAGYAPLLRALHGMFASCLAVRGGGGGDGEGTKLVDLVTGAEYVPTYEDKDGDWMLV GDVPWKMFVESCKRIRLMKSSEAVNLSPRRSSR</aaseq> |
| Gene Sequence |
<dnaseqindica>120..295#381..701#791..852#971..993#accaccacacccctcgtctccgcaaactcgacgcgccactcgacagcgaccccgcagccgatccatcccgccgccgaagcagcagcaaccgccacggtgcgccgccgccgccggtaccgatgtcgacgagctccggcgccgactcgtccccgcccgtctcgggcctcgactacgacgacaccgccctcaccctcgccctccccggctcctcctcctcctcctcctccaccgccgaccccgaacgcaagcgcgccgcccacgccgaccacgccgacgccaagccgccttccccaaagtacgtatagcttatgctctctttatggagattcctacgttcccgcgggtttctgacctggcgatcgatcgatgcgtgtgcgcagggcgcgggcggtggggtggccgccggtgagggcgtacaggcggaacgcgctgcgggaggactccgcgagggcgaagctggtcaaggtggccgtggacggcgcgccgtacctgcgcaaggtggacctcgcggcgcacgccggctacgcgcccctcctccgcgcgctccacggcatgttcgcctcctgcctcgccgtccgcggcggcggcggcggcgacggcgagggtacaaagctcgtcgacttggtcaccggcgccgagtacgtgcccacctacgaggacaaggacggcgactggatgctcgtcggcgacgtcccctggaagtaagcaacgcgtgtacacatctcaatcagttcttgccgattaattcaccgaaatcaaatgcaaaatctgatccgatcaatcaacacaggatgttcgtcgagtcctgcaagcggatccgtctcatgaagagctccgaggccgtcaacttatgtaagaacttgcgatccaatccactataataatccaataacattacattaccaactatactaattactgcaacgatcgatgagtgaatgacatttcgattctgaattttttgatgcagcgccaagacgatcatccagataatcgatcctaccacacgcaacgatgcaatgccgcaattgatctgtctgtctgtctgtctgtctgaattagttcgtctgaaagtgtgtgcaatggaagaggcttggctgtacaggtcctccatgcatatgtacctataccgtagtaggatcagtgatcgatgagccaaattggtgtgtgtactgtacaggccacaagaacgaaaatatcctctctctttaattcaggtgtgctccctgctgccggatcacggccggcccggtttggtttttggacgacggcggcgaggatcgatccaagggaggcgccgccacgccgccgcggcggtgtactttaattttcaagttgtcagctactttctgtaatttgtttcatgatggttcggtttcctgtgacagccagcacttttgttgtatgtcaaatgcaatgtatacatgatataccggttgttatcgttgttgttgctgttgttgactttgttctgtccattgatgcattgcaaggtcaaatataggagcacaataatctg</dnaseqindica> |
| External Link(s) |