Difference between revisions of "Os10g0445400"
Lymzzu2009 (talk | contribs) (→Expression) |
|||
| Line 29: | Line 29: | ||
| + | This study also examined the expression patterns of the interacting partner genes with OsHCI1 under two different heat stresses via semi-quantitative RT-PCR with rice seedlings treated by basal or acquired heat shock treatments (Fig.3). These results suggest that heat shock results in high expression of the OsHCI1 transcript or protein, which can affect the transcript levels of its interacting genes. | ||
| + | [[File:图片3.jpg]] | ||
| + | |||
| + | Fig3. Expression patterns of the response of interacting protein genes with OsHCI1 under heat treatment. | ||
===Localization === | ===Localization === | ||
Revision as of 15:18, 13 May 2014
OsHCI1 encodes a RING finger E3 ligases, which is specifically induced by heat and cold stress. OsHCI1 can drive nuclear export of multiple protein substrate, and the heterologous overexpression of Arabidopsis can enhance acquired-thermotolerance.
Contents
Annotated Information
Function
OsHCI1 (Oryza sativa Heat and Cold Induced 1) encodes a 246-amino acid protein with a predicted molecular mass of 28.8kDa and harbours a single RING-HC domain in its C-terminal region. It is a rice RING domain E3 ligase, and is highly induced under heat and cold stress conditions, which can lead to adverse outcomes in plant cell functions, including alterations in cellular composition of membrane fluidity and permeability, enzyme activity, metabolism, production of active oxygen species, and gene expression[1][2][3][4][5].
OsHCI1 dynamically moves from the cytoplasm to the nucleus along cytoskeletal tracts under heat shock conditions. OsHCI1 interacts with six substrate proteins and mediates subcellular trafficking of nuclear proteins to the cytoplasm via monoubiquitination.
Arabidopsis overexpressing OsHCI1-EYFP exhibits a heat-tolerant phenotype, suggesting an important role of this protein in the regulation of heat-generated signals in plants.
Expression
The finding that OsHCI1 gene expression patterns are specifically and somewhat rapidly increased by heat and cold stresses but not by salt and drought stresses indicates that the gene is associated closely with thermal stress in rice. And OsHCI1 rapidly responds to hormone treatments,too. (Fig.1)
Fig.1. Expression levels of OsHCl1 in rice plants subjected to four abiotic stresses and four hormonal treatments.
A Y2H screen was performed to identify 6 proteins that interact with OsHCI1. To confirm these positive interactions with OsHCI1, full-length coding sequences of the top six genes, which exhibited strong α-galactosidase activity, were cloned into GAL4 activation domain, respectively. Full-length OsHCI1 and each interacting protein were co-transformed into the Y2H Gold strain and grown on QDO/X/A medium(Fig.2).
Fig2.Identification of OsHCI1 interaction with six proteins.
This study also examined the expression patterns of the interacting partner genes with OsHCI1 under two different heat stresses via semi-quantitative RT-PCR with rice seedlings treated by basal or acquired heat shock treatments (Fig.3). These results suggest that heat shock results in high expression of the OsHCI1 transcript or protein, which can affect the transcript levels of its interacting genes.
Fig3. Expression patterns of the response of interacting protein genes with OsHCI1 under heat treatment.
Localization
BiFC technology was employed to visualize the interactions between OsHCI1 and each of the interaction partners in living cells [6]. Full-length coding sequences of OsHCI1 and each of the six interacting protein genes were cloned into the 35S-HA-SPYCE(M) and 35S-c-myc-SPYNE(R)173 vectors, respectively. All of the YFP signals except that of OsPSA7 appeared to associate with the cytoplasm and nucleus; however, the OsPGLU1-, OsbHLH065-, and OsGRP1-DsRed2 alone protein signals were detected only in the nucleus (Fig. 4B–D). In contrast, the OsHCI1 BiFC complex with OsPSA7 was localized to the cytoplasm with a punctuate complex (Fig. 5).
Fig. 4. Subcellular localization of six interacting proteins. Fig.5. BiFC assay for six substrate proteins confirms the interaction with OsHCI1 in living cells.
Wild type vs. Mutant
Several independent Arabidopsis transgenic lines (T3) were developed with strong OsHCI1 gene expression and compared to plants without the gene (35S:EYFP), which served as controls. The OsHCI1-overexpressing lines showed strikingly high survival rates; however, most control plants did not recover (Fig. 6).
Fig. 6. Thermotolerance phenotype of 35S:OsHCI1-EYFP
Labs working on this gene
1.Department of Applied Plant Sciences, Kangwon National University, Chuncheon 200-713, Korea.
References
- ↑ Kampinga HH, Brunsting JF, Stege GJ, Burgman PW, Konings AW. 1995. Thermal protein denaturation and protein aggregation in cells made thermotolerant by various chemicals: role of heat shock proteins. Experimental Cell Research 219, 536–546.
- ↑ Alfonso M, Yruela I, Almarcegui S, Torrado E, Perez MA, Picorel R. 2001. Unusual tolerance to high temperatures in a new herbicide-resistant D1 mutant from Glycine max (L.) Merr. cell cultures deficient in fatty acid desaturation. Planta 212, 573–582.
- ↑ Larkindale J, Knight MR. 2002. Protection against heat stress-induced oxidative damage in Arabidopsis involves calcium, abscisic acid, ethylene, and salicylic acid. Plant Physiology 128, 682–695.
- ↑ Larkindale J, Huang B. 2004. Thermotolerance and antioxidant systems in Agrostis stolonifera: involvement of salicylic acid, abscisic acid, calcium, hydrogen peroxide, and ethylene. Journal of Plant Physiology 161, 405–413.
- ↑ Larkindale J, Hall JD, Knight MR, Vierling E. 2005. Heat stress phenotypes of Arabidopsis mutants implicate multiple signaling pathways in the acquisition of thermotolerance. Plant Physiology 138, 882–897.
- ↑ Waadt R, Kudla J . 2008. In planta visualization of protein interactions using bimolecular fluorescence complementation (BiFC). CSH Protocols 2008, pdb prot4995.
Structured Information
| Gene Name |
Os10g0445400 |
|---|---|
| Description |
Zinc finger, RING-type domain containing protein |
| Version |
NM_001071244.2 GI:297610563 GeneID:4348743 |
| Length |
2212 bp |
| Definition |
Oryza sativa Japonica Group Os10g0445400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 10:16541690..16543901 |
| Sequence Coding Region |
16541849..16542062,16542867..16543089,16543187..16543253,16543374..16543610 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008403:16541690..16543901 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008403:16541690..16543901 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgagctgtgagttcttcctcccttcgccggtcgcggctcgtggacggtggtggtggtggggggtttgcgtgtggttcatctctctcttttgcagggcgtcggagttcttgcgggattacgacggggcggtgatccagatgcggatggcgtacagcgccgtcgcgcacttcctcgtgcagtggatcgactgcaagctcgccggcgcgctcggcctcctcaagatcatgatctacaaggtgtacgccgatggcaccacggctctgccggagtgggagagggaggccagcatcaggcaattctacggtgtcatcttcccgtcgctgctccagctgccgagtgggataactgaattggacgacaggaagcagaggaggctgtgccttcagaagttcaggaaggtggaggagagggtctcggaggtggatttggagagggagctcgagtgcggcatctgcctcgaggtgaatgccaagattgtgctgcccgattgcgcgcactcgctgtgcatgagatgcttcgaggattggaacaccaaatcaaagtcgtgccccttctgccgcgcctgcctcaagaaggtgaatccgagcagcctgtggttgtacaccgacgaccgcgatgttgtggatatggatacgttgactagggagaacattaggcgcctgttcatgttcataagtaagcttccacttgtagtgctccatgtggttgaccttgacatttacgagtaccgtatcaagtga</cdnaseq> |
| Protein Sequence |
<aaseq>MSCEFFLPSPVAARGRWWWWGVCVWFISLFCRASEFLRDYDGAV IQMRMAYSAVAHFLVQWIDCKLAGALGLLKIMIYKVYADGTTALPEWEREASIRQFYG VIFPSLLQLPSGITELDDRKQRRLCLQKFRKVEERVSEVDLERELECGICLEVNAKIV LPDCAHSLCMRCFEDWNTKSKSCPFCRACLKKVNPSSLWLYTDDRDVVDMDTLTRENI RRLFMFISKLPLVVLHVVDLDIYEYRIK</aaseq> |
| Gene Sequence |
<dnaseqindica>1840..2053#813..1035#649..715#292..528#ggggctcggattagagttggactcggcaacgcgacgagcaccaaaagcgagggaagaaaaccaatccgaatccggagagagaagcgcaggaggcaaaatccactccaattcaacccaatcacccgcggcgagccgagcgggcggcggagcacgacgacgacgaggtttaggtaggggttcttggcttgtcggcgtcggcggcggcggcggcggaggaggaggaggagtcagcgatgcggaggaggttccaggactccgtcaaggccctcgaggccgacatcgagcacgccaatgagctgtgagttcttcctcccttcgccggtcgcggctcgtggacggtggtggtggtggggggtttgcgtgtggttcatctctctcttttgcagggcgtcggagttcttgcgggattacgacggggcggtgatccagatgcggatggcgtacagcgccgtcgcgcacttcctcgtgcagtggatcgactgcaagctcgccggcgcgctcggcctcctcaagatcatgatctacaaggtctcgcccacacccccgcgccatcgccaattcgcagctgatttctcaccggctgggtaactaactaactaactaactaactaactaatcaccgggttcttgctggtaaatcgaatgcaggtgtacgccgatggcaccacggctctgccggagtgggagagggaggccagcatcaggcaattctacggtactactactcaatcgcaaccatctcctaacaacaagaacacgagcgattcaatttcatggttgtgatttctcaaattttttttgggtcgctgcaggtgtcatcttcccgtcgctgctccagctgccgagtgggataactgaattggacgacaggaagcagaggaggctgtgccttcagaagttcaggaaggtggaggagagggtctcggaggtggatttggagagggagctcgagtgcggcatctgcctcgaggtgaatgccaagattgtgctgcccgattgcgcgcactcgctgtgcatgagatgcttcgaggattggtaatttgccctcctccttcccctttaatttcccctctccttacattttcgcgcatgcgccaacacaaacatagagatattaggtactatcaattgttcatgttagaatcaaatatagctgttgcgtgctctaggagacaaaatttcgtttacctgaatgtggtgttcaagaaagagagaaaaagattacctttgccatatattggctggttgtgttcctcaggatgtaaagtcagttgtaaatctcctgcacttctgatagagtaccacaatgccctctccacagagtctttaaccatcttcatgcatcaagatgtagtccatccaatcaaacctgcatccagaatgactttatttataactgcagcaaacattctattgaactatgtcctgctcttgagcaggtaataacttattgatgtaaaagaagtaggcaaatagtcacaaaatgaactatatcatagatcggttgcatgatgctcctccaaaatacaaacctctgtatctggtaacaattctcaccttggttgaaggttacacacgcgcacacacagtctttgcatactctcttatgctgttagaaaactatgttgttctcagttcattgtatggttgacttcactttccttatagtcaatcctaagttgagagtgaatcattaaccactccttgtcagcaagcacaacaagatctgcaaccttgtccgtactcttcctacttgccgaggcgttcacttcgtctgatgcatgaatctgatcgaattccgtgggccatttaacgaaatttggcttgtcacatatgcaggaacaccaaatcaaagtcgtgccccttctgccgcgcctgcctcaagaaggtgaatccgagcagcctgtggttgtacaccgacgaccgcgatgttgtggatatggatacgttgactagggagaacattaggcgcctgttcatgttcataagtaagcttccacttgtagtgctccatgtggttgaccttgacatttacgagtaccgtatcaagtgaaactgtactcttttgttcataccggtgggtctctgtacatatcaaattcatcggtgctgatctgtgatagctcaacctgaggctgcaaattagcagagttgtttgtagctcaacgagttgataatatttttgtgaaaagaagatgctgaagtgtactcc</dnaseqindica> |
| External Link(s) |





