Difference between revisions of "Os11g0225100"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Evolution)
Line 14: Line 14:
 
Node supports are given in percentage of 1000 bootstrap replicates. The topology shows the condense consensus tree of the 1000 bootstrap
 
Node supports are given in percentage of 1000 bootstrap replicates. The topology shows the condense consensus tree of the 1000 bootstrap
 
replicates, with nodes with a bootstrap support <50% being collapsed. Branch lengths are proportional to phylogenetic distances estimated from the
 
replicates, with nodes with a bootstrap support <50% being collapsed. Branch lengths are proportional to phylogenetic distances estimated from the
JTT + G amino acid substitution model.
+
JTT + G amino acid substitution model.[[File: Phylogenetic analysis.jpg]]
[File:Phylogenetic_analysis.jpg]
 
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 16:12, 14 May 2014

Please input one-sentence summary here.

Annotated Information

Blast, caused by Magnaporthe oryzae, is one of the most widespread and destructive diseases of rice. The Oryza sativa (rice) resistance gene Pia confers resistance to the blast fungus Magnaporthe oryzae carrying the AVR-Pia avirulence gene. Pia , carried by cv. Aichi Asahi,is located on the short arm of chromosome 11.Associated with the rice leaf blast resistance which can make rice rice blast fungus produces a small species-specific resistance. Previous studies have shown that, the gene resistance spectrum of Pia is narrow, but widespread in Japanese rice varieties. the method of classical genetic is used to identify this gene. Have been cloned.(Okuyama et al., 2011)

Expression

Rice blast resistance gene Pia consists of two adjacentgenes RGA4 and RGA5 coding NBS-LRR protein.(Okuyama et al., 2011) Two NB-LRR protein-coding genes from rice (Oryza sativa), RGA4 and RGA5, were found to be required for the recognition of the Magnaporthe oryzae effector AVR1-CO39. RGA4 and RGA5 also mediate recognition of the unrelated M. oryzae effector AVR-Pia,thereby sparking an intense defense response of host plant to eliminate pathogens. RGA4 and RGA5 Confer Pi-CO39.jpg

Evolution

Phylogenetic relationship of the RATX1 domains of RGA5-A, Pik-1, Pikp-1, pi5-3, and closely related homologous RATX1 proteins from rice, reconstructed using the neighbor-joining distance method based on the alignment shown in figure :Phylogenetic_analysis Node supports are given in percentage of 1000 bootstrap replicates. The topology shows the condense consensus tree of the 1000 bootstrap replicates, with nodes with a bootstrap support <50% being collapsed. Branch lengths are proportional to phylogenetic distances estimated from the JTT + G amino acid substitution model.Phylogenetic analysis.jpg

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os11g0225100

Description

NB-ARC domain containing protein

Version

NM_001189506.1 GI:297728142 GeneID:9271293

Length

4104 bp

Definition

Oryza sativa Japonica Group Os11g0225100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 11

Location

Chromosome 11:6524851..6528954

Sequence Coding Region

6525228..6527270

Expression

GEO Profiles:Os11g0225100

Genome Context

<gbrowseImage1> name=NC_008404:6524851..6528954 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008404:6524851..6528954 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgagcaggcttgataagaactgctcaaagcaattgttgtccaagaaagcttgcccagagaggtattcacattacaagcagccagattcagcagcaattttgaagaaatgtgatggccagccacttgctcttgttaccataggtgaattcctgcaagctaatggctggccaacggggcctaactgtgaagatctctgcaatcggctacattatcacctagagaatgataaaacacttgaaaggatgcggcgagtgctggtccgcaactacactagtctacctggccatgctctcaaggcctgcttactatattttggtatgttcccatctgatcatccaatcaggaggaaaagtctgttgaggcgatggctggccgagggatttgtagaaccagtgtcttcatctagtaacctagattccacggctgctttcgatgtgctaatggaccggaacattattgagcccatcaatgtaagcaataatgataaagtcaagacatgccaaacgtacggtatgatgcgtgaattcatatcgcatatgtcaatctctcagaactttgtcacctttttctgtgatgacaagttcctgcccaaatatgttcgtcggctttctctccatggtgacactgttgtgaatggcgataacttcaacggtattgatttatcacttgtacggtctctggtagtctttggggaggcaggtacaactgtattagacttcagcaagtatcaattgctgcgagttttagatcttgaaaaatgtgatgatttgaacgatgatcatctcaaagaaatatgcaatctggtgcttctgaaatatctgagccttgggggtaatatctccaaacttccaaaggatattgccaaattgaaagatttggaggcactcgatgtaaggagatcgaaagtaaagataatgccggtagaagtcttcgggttgccatgcctaattcatctgcttggaaaatttaagctctcagataaagtcaagcagaagactgaagtgcaagagtttctctcgaaaggaaaaagcaacttgcagacgctagcaggatttgctagcaacggaagcgaagggtttctgcatcttatgaggtacatgaataagttgagaaagttgaagatttggtgtacgtcgtctgcaggtagcaccgattggactgatcttagggaggccattcaacagttcattctggatgaaaaggaagcaaatattggtacccgttctttatcgcttcatttcactggatgctctgaagatgcgataaattccttaaaagaaccctgctacctcagctcgttgaaattacatggcaacttcccccaattgcctcagtttgttacatcacttcgtggtctcaaggagctttgcctttcatctactaaatttacaacaggccttcttgaagccttgagtaatttgagctacttgcagtatctcaaactggttgccgatgaacttgagaagttcatcataaaagttcaggggttccccaggctgctatgcctttgtattgtgctacaatgtccaacattcccagtaattgaagaaggagctctgccatttcttgtcacacttcagctgctatgcaaagatctacatggcctttctgacatcaaaattgaatgttttaaacatcttcaggaggtaactcttcattctggagtcactccagctacaagacaggaatgggtaaaggctgctaaggagcatccgaataggccaaaagtattgcttctcaaatctgttgatacagcagaaagtgaacatacagacgttgatagtgtaatggaggcagtcaaaagtgagactacagaatattctattgcaccagagggaccagaacaagtgattgacatgaacaacaaaatgcaacttgaccatggattggaatcctcttctgtgctgaacaaacaaaacaattttgcagaccaatcaagctcaaaagatcaactgcattattctttcaacaatatggggctttcagatgtctctcctgctgtgagtgagctgccgaatggcatggtgccttcttgtacatga</cdnaseq>

Protein Sequence

<aaseq>MSRLDKNCSKQLLSKKACPERYSHYKQPDSAAILKKCDGQPLAL VTIGEFLQANGWPTGPNCEDLCNRLHYHLENDKTLERMRRVLVRNYTSLPGHALKACL LYFGMFPSDHPIRRKSLLRRWLAEGFVEPVSSSSNLDSTAAFDVLMDRNIIEPINVSN NDKVKTCQTYGMMREFISHMSISQNFVTFFCDDKFLPKYVRRLSLHGDTVVNGDNFNG IDLSLVRSLVVFGEAGTTVLDFSKYQLLRVLDLEKCDDLNDDHLKEICNLVLLKYLSL GGNISKLPKDIAKLKDLEALDVRRSKVKIMPVEVFGLPCLIHLLGKFKLSDKVKQKTE VQEFLSKGKSNLQTLAGFASNGSEGFLHLMRYMNKLRKLKIWCTSSAGSTDWTDLREA IQQFILDEKEANIGTRSLSLHFTGCSEDAINSLKEPCYLSSLKLHGNFPQLPQFVTSL RGLKELCLSSTKFTTGLLEALSNLSYLQYLKLVADELEKFIIKVQGFPRLLCLCIVLQ CPTFPVIEEGALPFLVTLQLLCKDLHGLSDIKIECFKHLQEVTLHSGVTPATRQEWVK AAKEHPNRPKVLLLKSVDTAESEHTDVDSVMEAVKSETTEYSIAPEGPEQVIDMNNKM QLDHGLESSSVLNKQNNFADQSSSKDQLHYSFNNMGLSDVSPAVSELPNGMVPSCT</aaseq>

Gene Sequence

<dnaseqindica>1685..3727#gtcagtcttccccttccccagctctccatcgaatcgtagcttgttgaaggtggaagatggaggccgcgcttctgagcggattcatcaaggccatcctgccgaggctcttctccctcgtcaacgacaagctcaatctgcacaagggcgtcaagggcgacatcgatttcctcatcaaggagctccgcatgatcgtcggcgccatcgacgacgacctctccgtcgaacatggcgccgccgccgccgccgccgccgtatctccatcgaatcgtagcttgttgaaggtggaagatggaggccgcgcttctgagcggattcatcaaggccatcctgccgaggctcttctccctcgtcaacgacaagctcaatctgcacaagggcgtcaagggcgacatcgatttcctcatcaaggagctccgcatgatcgtcggcgccatcgacgacgacctctccgtcgaacatggcgccgccgccgccgccgccgccgtacagacgctatgcatggaggacctccgcgagctcgcccacggcatcgaggactgcatcgacggcgtcctgtaccgcgccgccagggagcagcggcgctcttcgtcgcttctcccccgcacggtccgggcaaccaagaagttgctacagacaaaccagcatctggcccaggagttgcagcggctgaagaggatggtggaggaggcgaaccagcggaagcagaggtacacggcggcggcgcccggtcaacacggtcaggtctactcatcggctgcggcgcaggtggatgagccgtggccgtcgtgctcatctgcctcagatccgcgcatccacgaggcggacctggtcggcgtcgacgcggaccgggcggagctccttgagcagctggcggagcggcagccggagcagctcaaggtgatcgccatcgtcgggttctgcgggctggggaagaccgccctcgccgcggaggcgtacaaccgagagacccgcggcgggagattcgagaggcacgcgtgggtttgcgccgcgcaccggagtgcacgggaggtgctcggcgaattgctccgcaggattgacgcccgcttgccatggggactccgatgctggccagctgtgtgtagatatcagacaacagttggagaagaagaggtgaaaaatctcaactttctgcttgaattgcctgatccatttttcacatgaatttgaggtcaacattttagtcaactcgcctgttcttttgcacaagttcagtgcgactgacactttcaatagcaaagtgaatcatgaacagatactatatcttgctaactgctaggtgttagctgcactaatttagtcatcaaatgcatacagtgcatttctcatgcgctttatcttttacaaatttactataatagaataaaaatggaaaaaacaattcactgcttctaaattgctctaccgtatgaaattatacaaattattcgtttcaatttgttgattactgtggctccagatggggatgtttacaattattctttcttgatctgcctcgtcttgcaggtacttcattgttatcgatgacattcaaacagaagatcagtggaaaagcatcaaatcggcttttccgactgataaggatattggcagcagaatagtggtcacgacgaccatccagtcagtagctaatgcctgctgttctgcgaatgggtatttgcacaaaatgagcaggcttgataagaactgctcaaagcaattgttgtccaagaaagcttgcccagagaggtattcacattacaagcagccagattcagcagcaattttgaagaaatgtgatggccagccacttgctcttgttaccataggtgaattcctgcaagctaatggctggccaacggggcctaactgtgaagatctctgcaatcggctacattatcacctagagaatgataaaacacttgaaaggatgcggcgagtgctggtccgcaactacactagtctacctggccatgctctcaaggcctgcttactatattttggtatgttcccatctgatcatccaatcaggaggaaaagtctgttgaggcgatggctggccgagggatttgtagaaccagtgtcttcatctagtaacctagattccacggctgctttcgatgtgctaatggaccggaacattattgagcccatcaatgtaagcaataatgataaagtcaagacatgccaaacgtacggtatgatgcgtgaattcatatcgcatatgtcaatctctcagaactttgtcacctttttctgtgatgacaagttcctgcccaaatatgttcgtcggctttctctccatggtgacactgttgtgaatggcgataacttcaacggtattgatttatcacttgtacggtctctggtagtctttggggaggcaggtacaactgtattagacttcagcaagtatcaattgctgcgagttttagatcttgaaaaatgtgatgatttgaacgatgatcatctcaaagaaatatgcaatctggtgcttctgaaatatctgagccttgggggtaatatctccaaacttccaaaggatattgccaaattgaaagatttggaggcactcgatgtaaggagatcgaaagtaaagataatgccggtagaagtcttcgggttgccatgcctaattcatctgcttggaaaatttaagctctcagataaagtcaagcagaagactgaagtgcaagagtttctctcgaaaggaaaaagcaacttgcagacgctagcaggatttgctagcaacggaagcgaagggtttctgcatcttatgaggtacatgaataagttgagaaagttgaagatttggtgtacgtcgtctgcaggtagcaccgattggactgatcttagggaggccattcaacagttcattctggatgaaaaggaagcaaatattggtacccgttctttatcgcttcatttcactggatgctctgaagatgcgataaattccttaaaagaaccctgctacctcagctcgttgaaattacatggcaacttcccccaattgcctcagtttgttacatcacttcgtggtctcaaggagctttgcctttcatctactaaatttacaacaggccttcttgaagccttgagtaatttgagctacttgcagtatctcaaactggttgccgatgaacttgagaagttcatcataaaagttcaggggttccccaggctgctatgcctttgtattgtgctacaatgtccaacattcccagtaattgaagaaggagctctgccatttcttgtcacacttcagctgctatgcaaagatctacatggcctttctgacatcaaaattgaatgttttaaacatcttcaggaggtaactcttcattctggagtcactccagctacaagacaggaatgggtaaaggctgctaaggagcatccgaataggccaaaagtattgcttctcaaatctgttgatacagcagaaagtgaacatacagacgttgatagtgtaatggaggcagtcaaaagtgagactacagaatattctattgcaccagagggaccagaacaagtgattgacatgaacaacaaaatgcaacttgaccatggattggaatcctcttctgtgctgaacaaacaaaacaattttgcagaccaatcaagctcaaaagatcaactgcattattctttcaacaatatggggctttcagatgtctctcctgctgtgagtgagctgccgaatggcatggtgccttcttgtacatgacaaggatctagaatcttcacgtggcttcccggtcagttatttggacctgttgctttctgattgtgcattttgtgtttacttgtccttcacacaatcatcgtcatcaaaatacctttgatttcctacactccctgttacctcccttgatgaaatcagggggattcatgggcacagctacatgttctgtctgcattttgtatagtgacgtggcatacctagtacttgttttgtctccatcctgtttggcagagcaacaggttgtaataaatcttggttctaactggctgccctcagaatatgttgtctatagaatccacctgatagggaattcggccgtttgataatcctttatttttaagtctattgtttgtcctgag</dnaseqindica>

External Link(s)

NCBI Gene:Os11g0225100, RefSeq:Os11g0225100