Difference between revisions of "BGIOSGA024803"
(→Labs working on this gene) |
(→Labs working on this gene) |
||
| Line 17: | Line 17: | ||
1.State Key Laboratory of Plant Physiology and Biochemistry, National Center for Evaluation of Agricultural Wild Plants (Rice), Department of Plant Genetics and | 1.State Key Laboratory of Plant Physiology and Biochemistry, National Center for Evaluation of Agricultural Wild Plants (Rice), Department of Plant Genetics and | ||
Breeding, China Agricultural University, Beijing, 100094, China. | Breeding, China Agricultural University, Beijing, 100094, China. | ||
| + | |||
2.MOE Key Laboratory of Bioinformatics, Department of Biological Sciences and Biotechnology,Tsinghua University, Beijing, 100084, China. | 2.MOE Key Laboratory of Bioinformatics, Department of Biological Sciences and Biotechnology,Tsinghua University, Beijing, 100084, China. | ||
| + | |||
3.National Key Laboratory of Plant Molecular Genetics, Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 300 Fenglin Road, Shanghai 200032, China. | 3.National Key Laboratory of Plant Molecular Genetics, Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 300 Fenglin Road, Shanghai 200032, China. | ||
| + | |||
4.State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China. | 4.State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China. | ||
Revision as of 03:51, 15 May 2014
Please input one-sentence summary here.
BGIOSGA024803 gene derived from alleles of the generally cultivated evolution rice controls the prostrate growth of common wild rice, with the performance of upright growth and increasing spike grain number.
Contents
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
1.State Key Laboratory of Plant Physiology and Biochemistry, National Center for Evaluation of Agricultural Wild Plants (Rice), Department of Plant Genetics and Breeding, China Agricultural University, Beijing, 100094, China.
2.MOE Key Laboratory of Bioinformatics, Department of Biological Sciences and Biotechnology,Tsinghua University, Beijing, 100084, China.
3.National Key Laboratory of Plant Molecular Genetics, Shanghai Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 300 Fenglin Road, Shanghai 200032, China.
4.State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China.
References
Please input cited references here.
Structured Information
| Gene Name |
BGIOSGA024803 |
|---|---|
| Description |
Prostrate growth 1Putative uncharacterized protein |
| Definition |
Oryza sativa Indica Group BGIOSGA024803, complete gene. |
| LocusTag |
OSJNBB0050B07.12 |
| Ensembl Transcript ID |
BGIOSGA024803-TA |
| Ensembl Protein ID |
BGIOSGA024803-PA |
| Length |
504 |
| Source |
Oryza sativa Indica Group ORGANISM Oryza sativa Indica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 7:2808627..2809130 |
| Sequence Coding Region |
2808627..2809130 |
| Genome Context |
<gbrowseImage1> name=IndicaChromosome07:2808627..2809130 source=RiceIndica07 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=IndicaChromosome07:2808627..2809130 source=RiceIndica07 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>ATGGATCCCTCATCGGCTTCTTGGCCGGCTCCGGCTTCTCCGCCGGTGGAGCTGTCCCTGTCCCTGCCGGCGGCGGCGGCGAGGAACCGCGACGAGGCGGCGCCGACGGCGATCGTCGACGGCAAGCAAGTGAGGCTGTTCCCGTGCCTCTTCTGCGCCAAGACGTTCCGCAAGTCGCAGGCGCTCGGCGGCCACCAGAACGCGCACCGGAAGGAGCGCGTCGCCGGCGGCAGCTGGAACCCCAACGTCTACGGCGACGGCGGCGGATCAGCGTCCATGCCCATCGCCTCCCATGGCGTCACGGCGGCGGGGAGTAGTACGGCAGCCGACGGCCGGTGGTGCGGCGGCGCTGCCAGCGACGACGACACAACGGCGGCGCCCATGCCTTCCCTCGGCTCAGGCTCGGCGGCGCTCGGCGCCGGCGCCGGTTTCGCTTCGACCGAAAGGGGCTCTTCCGGCGGCGGCGTCGCCGGCGAGGAGCTTGTCCTCGAGCTCGGCCTCTAG</cdnaseq> |
| Protein Sequence |
<aaseq>MDPSSASWPAPASPPVELSLSLPAAAARNRDEAAPTAIVDGKQVRLFPCLFCAKTFRKSQALGGHQNAHRKERVAGGSWNPNVYGDGGGSASMPIASHGVTAAGSSTAADGRWCGGAASDDDTTAAPMPSLGSGSAALGAGAGFASTERGSSGGGVAGEELVLELGL</aaseq> |
| Gene Sequence |
<dnaseqindica>1..504#ATGGATCCCTCATCGGCTTCTTGGCCGGCTCCGGCTTCTCCGCCGGTGGAGCTGTCCCTGTCCCTGCCGGCGGCGGCGGCGAGGAACCGCGACGAGGCGGCGCCGACGGCGATCGTCGACGGCAAGCAAGTGAGGCTGTTCCCGTGCCTCTTCTGCGCCAAGACGTTCCGCAAGTCGCAGGCGCTCGGCGGCCACCAGAACGCGCACCGGAAGGAGCGCGTCGCCGGCGGCAGCTGGAACCCCAACGTCTACGGCGACGGCGGCGGATCAGCGTCCATGCCCATCGCCTCCCATGGCGTCACGGCGGCGGGGAGTAGTACGGCAGCCGACGGCCGGTGGTGCGGCGGCGCTGCCAGCGACGACGACACAACGGCGGCGCCCATGCCTTCCCTCGGCTCAGGCTCGGCGGCGCTCGGCGCCGGCGCCGGTTTCGCTTCGACCGAAAGGGGCTCTTCCGGCGGCGGCGTCGCCGGCGAGGAGCTTGTCCTCGAGCTCGGCCTCTAG</dnaseqindica> |
| External Link(s) |