Difference between revisions of "Os07g0641200"
(→Expression) |
(→Function) |
||
| Line 4: | Line 4: | ||
===Function=== | ===Function=== | ||
Ca2+/calmodulin-dependent protein kinase (CCaMK) has been identified as a | Ca2+/calmodulin-dependent protein kinase (CCaMK) has been identified as a | ||
| − | + | component of CSP, which is required for both rhizobial and mycorrhizal endosymbioses | |
| − | + | to take up nitrogen and phosphorus from soil, respectively . Legume CCaMK is a | |
| − | + | key player in the coordinated induction of infection thread formation and nodule | |
| − | + | organogenesis , providing fixed nitrogen in exchange for plant photosynthates as | |
| − | + | energy . Orthologs of CSP genes including CCaMK are also well conserved in | |
| − | + | non-leguminous plants.OsCCaMK in rice simultaneously controls CH4 oxidation and N2 | |
| + | fixation through the actions of methanotrophs and other N2 fixer under nitrogen-limited | ||
| + | paddy field conditions | ||
===Expression=== | ===Expression=== | ||
Revision as of 07:23, 15 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Ca2+/calmodulin-dependent protein kinase (CCaMK) has been identified as a
component of CSP, which is required for both rhizobial and mycorrhizal endosymbioses to take up nitrogen and phosphorus from soil, respectively . Legume CCaMK is a key player in the coordinated induction of infection thread formation and nodule organogenesis , providing fixed nitrogen in exchange for plant photosynthates as energy . Orthologs of CSP genes including CCaMK are also well conserved in
non-leguminous plants.OsCCaMK in rice simultaneously controls CH4 oxidation and N2 fixation through the actions of methanotrophs and other N2 fixer under nitrogen-limited
paddy field conditions
Expression
Oryza sativa CCaMK (OsCCaMK) genes were highly 56 expressed in roots of field-grown rice at vegetative and reproductive stages; such expression is required for mycorrhization
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os07g0641200 |
|---|---|
| Description |
Similar to CaMK1 |
| Version |
NM_001066961.2 GI:297607689 GeneID:4344066 |
| Length |
1740 bp |
| Definition |
Oryza sativa Japonica Group Os07g0641200, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 7:27343222..27344961 |
| Sequence Coding Region |
27343638..27343775 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008400:27343222..27344961 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008400:27343222..27344961 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>gaacttggacttggtccatcagtccctcttcatgttgtactccaagattggatcagacacgccgatgggaagcttagtttccttggattcattaaacttttgcacggagtttcttcgcgatcgatcccgaaagcctaa</cdnaseq> |
| Protein Sequence |
<aaseq>ELGLGPSVPLHVVLQDWIRHADGKLSFLGFIKLLHGVSSRSIPK A</aaseq> |
| Gene Sequence |
<dnaseqindica>1187..1324#gtgattgcctacattttgctttgtgggagccgtcctttctgggcacgcaccgaatcaggaatatttcgagctgtgctgaaggcagaaccaagttttgatgaggctccatggcctactctcactgccgaagcaaaagactttgtaaaacgactgcttaataaggattaccgcaagaggatgactgctgcacaagctctcagtaagcatcagatttgtttgtcagtgtaatattgtggcactcgctttttatcgaatgatggttaattgctcacttgcatcatgatatctgcaggtcatccgtggatccgaaattctcaacaagtgaaaatacctttagatatgataatctacaagcttatgcgagcttatatcagttcgtcttccttgcggaagtccgctttgagggtatgcataaacctttgtgttgttcttatctggtctgtaaatgactattcttgctgcttatattttttttcattttttacatgtgtcaagttatccatgtacgagcaatatattgcttttggttgtgcagtttaagtaggcttataccgatatgtcttgactctgatgacatcaccaactagccattttaagcaatgtccatacattttgcaggccctagctaagacattgacggcaaatcaactgttctatctaagagagcaatttgaattgttgggtccaaacaagaatggttatatctccttgcaaaatttgaaaacggtaggtattctcacctttgttacttgatctaatttatagcatgcaattgctgaataagtaaatgttcctacaggccttggtaaagaattctacagatgcaatgaaggattctagggttattgactttgttaacacggtaagactctttcatagaacattctcttgtgttagtatatcggactgagataaacactgacctgctcaagccatggtactaggtgtgcactcttcagtacagaaaattggattttgaagagttcgctgcttctgccgtcagcgtttatcagatggaagctttggaaacatgggagcagcacgcacggcgtgcatacgagctattcgataaggagggcaaccgacctattgtaattgaggagcttgcatcggtatgatttgagctgaagtaactttttcgcatgattattaaacatttctaactgttatatttttcatctcttaggaacttggacttggtccatcagtccctcttcatgttgtactccaagattggatcagacacgccgatgggaagcttagtttccttggattcattaaacttttgcacggagtttcttcgcgatcgatcccgaaagcctaagataaaatcattcttgcatcaaccaatgaggtcaaattgatggctaagccaaattctctggatggtgttcgttgtgttgcgcggtttgaggtggttggagaggatgtcttgaaaatcagacaaaaaaaagaaagtgacagtttgtgtaagaggtgaaaatgttcttgctgctactacttctacccctccccttcgccacgtcggattgatgttgtactgaagctgtgtagacgatgtacagatgatgaggataggaaaaagaatatggaagggttgaaaagatttgagactggtgtttgtcaaagtcttgcattgtagtagtgcatcttttgtctcaaataagacatttaacgtctcaccccttggtctctcattgtgttattatgccagtatgcgacagccctgaggttacagat</dnaseqindica> |
| External Link(s) |
