Difference between revisions of "Os02g0580300"

From RiceWiki
Jump to: navigation, search
(Function)
(Annotated Information)
Line 5: Line 5:
 
The GID2 gene encoded a 639-base-pair open reading frame capable of producing a
 
The GID2 gene encoded a 639-base-pair open reading frame capable of producing a
 
polypeptide of 212 amino acid residues. The deduced amino acid sequence of GID2 contained an F-box domain.<ref>1</ref>F-box domains are found in specific components of the multisubunit SCF E3 ubiquitin ligase complex.<ref>2</ref>
 
polypeptide of 212 amino acid residues. The deduced amino acid sequence of GID2 contained an F-box domain.<ref>1</ref>F-box domains are found in specific components of the multisubunit SCF E3 ubiquitin ligase complex.<ref>2</ref>
GID2 influences the rice height through regulating GA signaling. GID2 is a component of the SCF complex through an inieraction with a rice ASK1 homolog,OsSkp 15.<ref>3</ref> GID2 is a positive regulator of GA signaling and that regulated degradation of SLR1 is initiated through GA-dependent phosphorylation and finalized by an SCFGID2-proteasome pathway.<ref name="foo">1</ref>
+
GID2 influences the rice height through regulating GA signaling. GID2 is a component of the SCF complex through an inieraction with a rice ASK1 homolog,OsSkp 15.<ref>3</ref> GID2 is a positive regulator of GA signaling and that regulated degradation of SLR1 is initiated through GA-dependent phosphorylation and finalized by an SCFGID2-proteasome pathway.<ref 1="foo">1</ref>
  
 
===Expression===
 
===Expression===

Revision as of 08:28, 15 May 2014

Please input one-sentence summary here.

Annotated Information

Function

The GID2 gene encoded a 639-base-pair open reading frame capable of producing a polypeptide of 212 amino acid residues. The deduced amino acid sequence of GID2 contained an F-box domain.[1]F-box domains are found in specific components of the multisubunit SCF E3 ubiquitin ligase complex.[2] GID2 influences the rice height through regulating GA signaling. GID2 is a component of the SCF complex through an inieraction with a rice ASK1 homolog,OsSkp 15.[3] GID2 is a positive regulator of GA signaling and that regulated degradation of SLR1 is initiated through GA-dependent phosphorylation and finalized by an SCFGID2-proteasome pathway.Cite error: Invalid <ref> tag; invalid names, e.g. too many

Expression

The GID2 gene is expressed at different levels in all organs, preferentially expressed in unopened flowers, shoot apices, and elongation stem, and at lower levels in the leaf blades, leaf sheaths, roots, and rachis. Expression of GID2 preferentially occurs in rice organs actively synthesizing GA.[4]

Mutant

The gid2 is a rice GA-insensitive dwarf mutant. The gid2 mutant shows a severe dwarf phenotype with wide leaf blades and dark green leaves.[5]The gid2 mutants exhibit reduced GA responses and don’t resume normal growth when treated with GA.[6] In gid2, a repressor for GA signaling, SLR1, is highly accumulated in a phosphorylated form and GA increases its concentration in the wild type.[7] Dgradation of SLR1 protein does not occur in gid2 mutants. The accumulated SLR1 is located in the nuclei, as it is in the wild type.[8]

Evolution

The F-box domain in GID2 is well conserved in other F-box proteins, with the greatest similarity to Arabidopsis SLY1, which is a positive regulator of GA signaling.[9]F-box proteins occur widely throughout the eukaryote kingdom, in organisms ranging from yeast to humans, and they function as receptors that recuit proteins as substrates for ubiquitin-mediated degradation in the 26S proteasome.[10]


You can also add sub-section(s) at will.

Labs working on this gene

1 BioScience Center, Nagoya University, Nagoya, Japan.

2 BioResources Center, Riken, Tsukuba, Japan.

3 Division of Molecular and Life Science, Pohang University of Science and Technology, Republic of Korea.

4 Graduate School of Bioagricultural Science, Nagoya University, Nagoya, Japan.

References

1 Sasaki A.;Itoh H.;Gomi K.;Ueguchi-Tanaka M.;Ishiyama K.;Kobayashi M. Jeong DH.;An G.;Kitano H.;Ashikari M.;Matsuoka M Accumulation of phosphorylated repressor for gibberellin signaling in an F-box mutant. Science, 2003, 299: 1896-1898.

2 Nicholas P. Harberd. Relieving DELLA Restraint . Science, 2003, 299(5614): 1853-1854.

3 Kenji Gomi;Akie Sasaki;Hironori Itoh;Miyako Ueguchi-Tanaka;Motoyuki Ashikari;Hidemi Kitano;Makoto Matsuoka. GID2, an F-box subunit of the SCF E3 complex, specifically interacts with phosphorylated SLR1 protein and regulates the gibberellin-dependent degradation of SLR1 in rice. The Plant Journal, 2004, 37(4): 626-634

Structured Information

Gene Name

Os02g0580300

Description

Similar to 14-3-3 protein 6

Version

NM_001053769.1 GI:115446908 GeneID:4329775

Length

4099 bp

Definition

Oryza sativa Japonica Group Os02g0580300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:23191177..23195275

Sequence Coding Region

23193203..23193612,23193701..23193779,23193940..23194062,23194724..23194840,23194935..23194994

Expression

GEO Profiles:Os02g0580300

Genome Context

<gbrowseImage1> name=NC_008395:23191177..23195275 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:23191177..23195275 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtcgcagcctgctgagctttcccgtgaggagaatgtgtacatggctaagcttgcagagcaggccgagaggtatgaggagatggttgagttcatggagaaggttgctaagacagttgactctgaggagctcactgttgaggagcgcaaccttctatcagttgcttacaagaatgttattggtgctcgccgtgcgtcatggcgcatcatatcatccattgaacagaaggaagagagccgtggtaatgaggatcgttgcacgctcatcaaggaatacaggggaaagattgaaactgagctctccaagatctgtgatggcatcctcaagcttcttgactcccaccttgtgccttcatccactgctccagagtccaaggtcttctacctcaagatgaaaggcgactactacaggtacctcgcagagtttaagactggagctgagaggaaggatgctgctgagaacaccatggtggcatacaaagccgctcaggatattgccctggcagagttgcccccaactcatcctatcagacttgggctggccctcaacttctcggtgttttattacgagatcctcaactctcctgaccgtgcttgcaatcttgcaaagcaggctttcgatgaggctatctcagagctggacactctgagtgaggaatcctacaaggacagcactttgatcatgcagcttctgcgtgataacctgacgctgtggacttccgatatctcggaggatgctgctgaggaaatcaaggaggcccccaagggcgaatcaggagatggacagtga</cdnaseq>

Protein Sequence

<aaseq>MSQPAELSREENVYMAKLAEQAERYEEMVEFMEKVAKTVDSEEL TVEERNLLSVAYKNVIGARRASWRIISSIEQKEESRGNEDRCTLIKEYRGKIETELSK ICDGILKLLDSHLVPSSTAPESKVFYLKMKGDYYRYLAEFKTGAERKDAAENTMVAYK AAQDIALAELPPTHPIRLGLALNFSVFYYEILNSPDRACNLAKQAFDEAISELDTLSE ESYKDSTLIMQLLRDNLTLWTSDISEDAAEEIKEAPKGESGDGQ</aaseq>

Gene Sequence

<dnaseqindica>2027..2436#2525..2603#2764..2886#3548..3664#3759..3818#acaggagaagccgcagccactgaggtaaactgctcctcctcgccgatttcccccctcctttttctctaataccaaattactcgagaaattgtgttggttcggtccgcgggtagcgtgattcggccagatctggcgtctgtgtgtgtggagaattcgagggttttgtttgggtttgtggggggagtaaatccggacgaatctgtggtggtttgggggggaattcggtgtgtgtttgagttgatttgagttcgtggatgattccgttggatattgataggtcctagttctgatccagaagtggcggctacgcctttgctgtagcctcaccgatccgccgccgccgccgccatgaagttccgctctgattcgtcaggcggcgacgagccccgcgctccggctgccggcgacggcggcggcggcggcgacgagccggccaagaggcagcggaccgatccgtcctccagttcgagccagggcgaggcctcctcttcctcgcagccgccaccgcagcagcagcaggaggagcagcctccggaggatgcgggagagggcgagcagccgagggttccggatctcggggaggacctggtgttcgaggtgctgcggcgagcggaggcgcggacgctggcggccgcggcgtgcgtgagcagggggtggcggcagctcgcggaggacgagcggctctgggaggccgcgtgcgtgcgggagtgggcgaacctcggcttctccgagcggcagctccgggccgtggtgctctccctcggtggattccgccggctccacgctgtctacatccgccccctgcagtggcgtggcgccggcgtgcccaggcaacaggggaggcggcagccgccggtgaggttgggccgggaccaggttcagctctcgctgtcactgttctccattgggttctttcagaatatgccttgtcctaagaaagacaagggaaatgacagtgataagaatggagggggccaatgcgggtagtcgaatttgtggaataagcttcactccaacaagcatcatcctaagctaccatggcagttgccctattgttcacactggtgatgctagagagtgttggagagacgaacaggaaaatcggcatgcttgatttgggacatgagagaaattaagtggaattgcaagatctgaattggttcggttgtgttccgcacttgtaagatttatgtgatagtgtcacatggattgatggacgttgagtgctatgaggacagttgcgtgaatgctgatgacaagtgatttacttcaagagaagggagaaatggtttgcaattcgttctgctgttgctgatattctagttatcagctattgtgtcaacttgatatatctggcccaagagcagtatggactgtgtgccttcttgcgccggtaccaagctttagagggaaagctgatgcaaatagcttttgtttgcataacctttttcaattagggaaacataatttcccatattaggcatatggagaattatgtgaggtattgattgtttgtacaaaaataaccattttattcttgaatattgcattttcacatgttaactaaggttcttaagttgatctgactgccatgtacaatatggagcccaacaaggggtagtgacacatatttctcaacttcagtatgcaataagtcagtcattttatatgtttttacatgtggagctgcggataatgtgacaaacttatgtaatcgtgaatgatcttttgatgtttctctgtttttctttcatgtagtttgatataggattcctttatctggcactattgaagttttgttgtaaataatgttattcttgcaaagattatcttaaatcaatcatttctggatctgaagaggtattgtaacaatctgaagctttgcacaaccaattgcaactaaacttttgtatttcttagggtgaggacttgaggttggtgtgatgggcatttagctaactgaaatttctctcaaacctcacagatttgaccttctgtttctaccagaaaaacacaaacagtgaagatgtcgcagcctgctgagctttcccgtgaggagaatgtgtacatggctaagcttgcagagcaggccgagaggtatgaggagatggttgagttcatggagaaggttgctaagacagttgactctgaggagctcactgttgaggagcgcaaccttctatcagttgcttacaagaatgttattggtgctcgccgtgcgtcatggcgcatcatatcatccattgaacagaaggaagagagccgtggtaatgaggatcgttgcacgctcatcaaggaatacaggggaaagattgaaactgagctctccaagatctgtgatggcatcctcaagcttcttgactcccaccttgtgccttcatccactgctccagagtccaaggtcttctacctcaagatgaaaggcgactactacaggtattacaatagttcctggcatagcagtctttaatttctatttctttatattgtcaagttcatgtgtttgaatgtatgtgtttgataggtacctcgcagagtttaagactggagctgagaggaaggatgctgctgagaacaccatggtggcatacaaagccgctcaggtggtttccttaacagtgaatttgttgttgcggcatcctgtttgtttgtttgtgccattttgcaattttgattcggggtattcagctaaagttatttgtgatgtgttctcctttggtctgttttgtttttctgaatattgttggtgataaaatctttcaggatattgccctggcagagttgcccccaactcatcctatcagacttgggctggccctcaacttctcggtgttttattacgagatcctcaactctcctgaccgtgcttgcaatcttgcaaagcaggtttaatttctactgcattctatttcattatttgtgaattggaggaccatatggagttgagaagatattttgaagtttataccattgttgtgaaatataatgtcttagtaattgggattgaacaaataacatgtatgaattagtaatacacctggaacaggttctacttagttctgttagcaaatagcaaagtgtaggctccttaatgcaagtaagctgaacgggttaggtgcattgtcatgatggattttcttcattaagaatacttgatagaaaatgatgaatcaaataagaggtgtaagaaattatagtttacagttacagatttgcccaccttgaatacttgagtgcttctaaataactgatgaagtccgagcatcactatggccattgtgacgtggaacaagcttgtctcaatatggccatcgttcattcatagaggcctaccagtttgttctgtaatttgttaataatagatatctgatgtatatagaatggtttactgcagacaagtttgctataagttcactgctttgtccatggatataattgatcttggacttggagcacacattatgtgccttactttatgaaacttgcttgtgctagtacttatatttgccatcataatagaatgtgacagtaacctactttatctcaggctttcgatgaggctatctcagagctggacactctgagtgaggaatcctacaaggacagcactttgatcatgcagcttctgcgtgataacctgacgctgtggacttccgatatctcggtattttcttcgccgctagcatatatatttgcacttgcatcatattgtctttggaatcatcttaaatgcgtaaattccatgtgtgcggcttcaggaggatgctgctgaggaaatcaaggaggcccccaagggcgaatcaggagatggacagtgaacatgatcgaatgcgtgcgcccacaaactagaatagtgacgctgcaaatgtgctgtgggttatcgtttcattttatagattgtaatgtctcgtgatttgtcggaaacaggaggcgctccccatttatgttgtgctaggaaaccttgcagctgactcgctgcttggctggtggattctcgagctgcactttctttggggggagcctcagggtggaaccttcatgtcacttattggatcgattgttttcggtatgtcagttgtgagccttatctccagagtcc</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0580300, RefSeq:Os02g0580300

  1. 1
  2. 2
  3. 3
  4. 3
  5. 1
  6. 2
  7. 1
  8. 3
  9. 1
  10. 3