Difference between revisions of "Os01g0113350"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
Please input one-sentence summary here.
 
 
This gene encode a sweet-tasting basic protein thaumatin, and the gene expression is induced by pathogen.[1]
 
This gene encode a sweet-tasting basic protein thaumatin, and the gene expression is induced by pathogen.[1]
 
==Annotated Information==
 
==Annotated Information==
Line 8: Line 7:
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
  This thaumatin-like protein is derived from the rice cultivar Nipponbare[5]. The name 'thaumatin-like' from its homology with thaumatin. Thaumatin is firstly extracted from the fruit ''Thaumatococcus daniellii'' growing in West Africa[6]. Thaumatin-like proteins are in diverse plants, and can be isolated from  Hordeum vulgare (barley),  Actinidia deliciosa(kiwifruit), Zea mays (maize), Pseudotsuga menziesii (douglas-firs), Nicotiana tabacum (tobacco),  Solanum lycopersicum (tomato) and Triticum sp. (wheat) . Most of the thaumatin-like protein have a molecular weight in the range of 18 kDa to 25 kDa and have a pH in the range from 4.5 to 5.5[2].
  
 
===Evolution===
 
===Evolution===

Revision as of 14:22, 15 May 2014

This gene encode a sweet-tasting basic protein thaumatin, and the gene expression is induced by pathogen.[1]

Annotated Information

Function

  This gene encodes a thaumatin-like protein. Thaumatin belongs to the pathogen response 5(PR5) family, and is only exclusively expressed in pathological conditions such as paramicrobe infection or mechanical damage[2]. Therefore, it is thought that this protein is involved in acquired systematic resistance and the response to biotic stress; the latter process leads to microbe growth inhibition and spore germination reduction[2]. However, the precise mechanism in rice is unknown. In addition, this thaumatin-like peotein harbors ATP-binding potentiality and  Serine/threonine-protein kinase activity according to the homology prediction[3]. And an attractive feature of this protein is its sweet flavor, and this feature may be used in food industry[4].

Expression

  This thaumatin-like protein is derived from the rice cultivar Nipponbare[5]. The name 'thaumatin-like' from its homology with thaumatin. Thaumatin is firstly extracted from the fruit Thaumatococcus daniellii growing in West Africa[6]. Thaumatin-like proteins are in diverse plants, and can be isolated from  Hordeum vulgare (barley),  Actinidia deliciosa(kiwifruit), Zea mays (maize), Pseudotsuga menziesii (douglas-firs), Nicotiana tabacum (tobacco),  Solanum lycopersicum (tomato) and Triticum sp. (wheat) . Most of the thaumatin-like protein have a molecular weight in the range of 18 kDa to 25 kDa and have a pH in the range from 4.5 to 5.5[2].

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0113350

Description

Thaumatin-like, pathogenesis-related 5 family protein

Version

NM_001185208.1 GI:297719550 GeneID:9271284

Length

2469 bp

Definition

Oryza sativa Japonica Group Os01g0113350, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:727977..730445

Sequence Coding Region

727977..729455,729750..729854,730389..730445

Expression

GEO Profiles:Os01g0113350

Genome Context

<gbrowseImage1> name=NC_008394:727977..730445 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:727977..730445 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcggcagtgtctacttgttgcactcaccatctcctacctctactcctcctcgctgccatagtcgccaccaccaccaccaaccacgccgccgccgccgccacgttgaacatcaccaacctatgccccttcaccgtgtggccggccgccgtgccggtgggcggcggcaggcggctcgacccgggcacgtcgtgggcgctcgacgtgcccgccggcgccgccccgggccgcgtgtgggcgcgcacgggctgcaccttcgacgccaccggcgccaacgggacgtgcctgacgggcgactgcggcggcgcgctgtcgtgcacgggctacggcgagccgccgcagacgctcgccgagttctcgctcggccaggccgacggccaggacctcttcgacatctccctcgtcgacggcttcaacgtgcccatggacttcctcccggcgccgccgccggatcagtcaccgccgtgcagcaaggggccacggtgtccggccaacgtcacggcacagtgccccggcgagctcagagctcatggaggctgcaacagcgcgtgcagagtgttcaagcaggacaaatactgctgcactggcaacgggacgaacacctgcgaacccaccacctactcgctgccatttgtgaggatgtgcccggacgcctatagctactccaggaacgatgcatccagcccagggttcacttgcccgtcaggtacaaattaccagatcatcttctgccccccaattgatctcacatcttcatctcctgcatcaattgctgttgctgcaaataacagacaaggaaaaaaggttattgccgggatcatcatagcttctgtaatcggctccacttcagtactcaccatggttatggcttacaccagcatcaagcgaagaacacgacggcgccgggagatacgtgaagaggagcaggagcttgaggagataacccttcaaggaatgccaaggaggttcacatttcagcagctacaggaagcaaccgatcagttcagagataagctcggtgaaggaggatttgggtcggttttcttgggacagattggagacgaaagagttgcggtgaaacgcctggatcgaaatggtcaggggatgagagaattcttggcagaggttcagacgatcggcagcatccaccatatcaatctggtgaggctgattggattctgtgcagagaaatcacagaggctcttggtttatgagcatatgcccaaaggttccttggacaggtggatctatcaccagcaaggtgctgctatttttcctagtgttcctcctctagattggcaaacacgatacaaaattattacccaagtagccaaaggtctctcataccttcatgaggagtgcacaaagagaattgctcacttggatgtaaaaccacaaaatatcctcctggatgacaaattcaatgctaaactctctgattttggactatgcaagctcattgatcgagataagagccaaatcgattgcaaaaggaggcctcaaatgtctgaggttgtaaaagcattggaaggcaccataagtatcgaaactaacatagttcatgattttgtcgcagtaaatccacctcagttttacaacctacctaccaccttatctgagaaaaaacaacaaccaacttag</cdnaseq>

Protein Sequence

<aaseq>MAAVSTCCTHHLLPLLLLAAIVATTTTNHAAAAATLNITNLCPF TVWPAAVPVGGGRRLDPGTSWALDVPAGAAPGRVWARTGCTFDATGANGTCLTGDCGG ALSCTGYGEPPQTLAEFSLGQADGQDLFDISLVDGFNVPMDFLPAPPPDQSPPCSKGP RCPANVTAQCPGELRAHGGCNSACRVFKQDKYCCTGNGTNTCEPTTYSLPFVRMCPDA YSYSRNDASSPGFTCPSGTNYQIIFCPPIDLTSSSPASIAVAANNRQGKKVIAGIIIA SVIGSTSVLTMVMAYTSIKRRTRRRREIREEEQELEEITLQGMPRRFTFQQLQEATDQ FRDKLGEGGFGSVFLGQIGDERVAVKRLDRNGQGMREFLAEVQTIGSIHHINLVRLIG FCAEKSQRLLVYEHMPKGSLDRWIYHQQGAAIFPSVPPLDWQTRYKIITQVAKGLSYL HEECTKRIAHLDVKPQNILLDDKFNAKLSDFGLCKLIDRDKSQIDCKRRPQMSEVVKA LEGTISIETNIVHDFVAVNPPQFYNLPTTLSEKKQQPT</aaseq>

Gene Sequence

<dnaseqindica>1..1479#1774..1878#2413..2469#atggcggcagtgtctacttgttgcactcaccatctcctacctctactcctcctcgctgccatagtcgccaccaccaccaccaaccacgccgccgccgccgccacgttgaacatcaccaacctatgccccttcaccgtgtggccggccgccgtgccggtgggcggcggcaggcggctcgacccgggcacgtcgtgggcgctcgacgtgcccgccggcgccgccccgggccgcgtgtgggcgcgcacgggctgcaccttcgacgccaccggcgccaacgggacgtgcctgacgggcgactgcggcggcgcgctgtcgtgcacgggctacggcgagccgccgcagacgctcgccgagttctcgctcggccaggccgacggccaggacctcttcgacatctccctcgtcgacggcttcaacgtgcccatggacttcctcccggcgccgccgccggatcagtcaccgccgtgcagcaaggggccacggtgtccggccaacgtcacggcacagtgccccggcgagctcagagctcatggaggctgcaacagcgcgtgcagagtgttcaagcaggacaaatactgctgcactggcaacgggacgaacacctgcgaacccaccacctactcgctgccatttgtgaggatgtgcccggacgcctatagctactccaggaacgatgcatccagcccagggttcacttgcccgtcaggtacaaattaccagatcatcttctgccccccaattgatctcacatcttcatctcctgcatcaattgctgttgctgcaaataacagacaaggaaaaaaggttattgccgggatcatcatagcttctgtaatcggctccacttcagtactcaccatggttatggcttacaccagcatcaagcgaagaacacgacggcgccgggagatacgtgaagaggagcaggagcttgaggagataacccttcaaggaatgccaaggaggttcacatttcagcagctacaggaagcaaccgatcagttcagagataagctcggtgaaggaggatttgggtcggttttcttgggacagattggagacgaaagagttgcggtgaaacgcctggatcgaaatggtcaggggatgagagaattcttggcagaggttcagacgatcggcagcatccaccatatcaatctggtgaggctgattggattctgtgcagagaaatcacagaggctcttggtttatgagcatatgcccaaaggttccttggacaggtggatctatcaccagcaaggtgctgctatttttcctagtgttcctcctctagattggcaaacacgatacaaaattattacccaagtagccaaaggtctctcataccttcatgaggagtgcacaaagagaattgctcacttggatgtaaaaccacaaaatatcctcctggatgacaaattcaatgctaaactctctgattttggactatgcaagctcattgatcgagataagagccaagtgattacaagaatgagaggcacacctggatatttagctcctgaatggctgacatcgcagatcacagaaaaggcagatgtctatagctttggcatagtagtcatggaaatcatcagcggaagaaagaatgttgacacttcccggtctgaacagagcatccatctaattaccttattgcaagaaaaggtgaagagtgatcagttggtagatttgattgacaaagataataatgacatgcaagtacacgagcaagaagtaatagagatgatgaaatttgcaatgtggtgtttgcagatcgattgcaaaaggaggcctcaaatgtctgaggttgtaaaagcattggaaggcaccataagtatcgaaactaacatagttcatgattttgtcgcagtaaatccagtaagctttggttttactgcagttgtgggctcagctccacctcttgcctcagatctatccggacccaggtgactgacgcaattttgatggtatactagaacatgtgcgcttttgggtcagaaaaaggcatagcatatacgctgttgcattctcagaaaactataatgtgatagcatcataccttcaaatcatttacattttttaatattgcaattttcgttcaagaagaacatctcaatattgtttgattgtttctgttgaacttgccctattagcaaatctgatcctggttcatacatgtgaaaccaatagctcttcttacatatcaaaatggtcatagctctcatggcactttcaaccataattcagtagtactttctcatggcacaaatacaacttttatcgtatgcaaatgaatagcgtaccacaagatcacatttttctcgttccagctttatactctgttattccctaaaaaaaatcactttcaaattacaacaatgcgatgaaacatctgtttacaacaatatgtagcctcagttttacaacctacctaccaccttatctgagaaaaaacaacaaccaacttag</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0113350, RefSeq:Os01g0113350