Difference between revisions of "Os03g0411500"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 7: Line 7:
 
In several bacteria, such as E. coli, proteins tagged with the SsrA peptide (ANDENYALAA) encoded by tmRNA are digested by Clp proteases.[3]
 
In several bacteria, such as E. coli, proteins tagged with the SsrA peptide (ANDENYALAA) encoded by tmRNA are digested by Clp proteases.[3]
 
The protein encoded by this gene belongs to the peptidase family S14 and hydrolyzes proteins into small peptides in the presence of ATP and magnesium. The protein is transported into mitochondrial matrix and is associated with the inner mitochondrial membrane.[2]
 
The protein encoded by this gene belongs to the peptidase family S14 and hydrolyzes proteins into small peptides in the presence of ATP and magnesium. The protein is transported into mitochondrial matrix and is associated with the inner mitochondrial membrane.[2]
Rice yellow leaf mutant vyl, the performance of the entire growth period, new leaves chlorotic phenotype, then gradually turn green from the top down.
+
Rice yellow leaf mutant vyl, the performance of the entire growth period, new leaves chlorotic phenotype, then gradually turn green from the top down.[4]
  
 
===Expression===
 
===Expression===

Revision as of 02:34, 17 May 2014

Please input one-sentence summary here.

Annotated Information

Function

A nuclear gene coding protein positioned in mitochondrion. ATP-dependent Clp protease proteolytic subunit is an enzyme that in humans is encoded by the CLPP gene.[1][2] It is found in mitochondria and is widely distributed in bacterial species. In several bacteria, such as E. coli, proteins tagged with the SsrA peptide (ANDENYALAA) encoded by tmRNA are digested by Clp proteases.[3] The protein encoded by this gene belongs to the peptidase family S14 and hydrolyzes proteins into small peptides in the presence of ATP and magnesium. The protein is transported into mitochondrial matrix and is associated with the inner mitochondrial membrane.[2] Rice yellow leaf mutant vyl, the performance of the entire growth period, new leaves chlorotic phenotype, then gradually turn green from the top down.[4]

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

1.Bross P, Andresen BS, Knudsen I, Kruse TA, Gregersen N (Feb 1996). "Human ClpP protease: cDNA sequence, tissue-specific expression and chromosomal assignment of the gene". FEBS Lett 377 (2): 249–52. doi:10.1016/0014-5793(95)01353-9. PMID 8543061. 2. a b "Entrez Gene: CLPP ClpP caseinolytic peptidase, ATP-dependent, proteolytic subunit homolog (E. coli)". 3. Gottesman S, Roche E, Zhou Y, Sauer RT (1998). "The ClpXP and ClpAP proteases degrade proteins with carboxy-terminal peptide tails added by the SsrA-tagging system". Genes Dev 12 (9): 1338–47. doi:10.1101/gad.12.9.1338. PMC 316764. PMID 9573050

Structured Information

Gene Name

Os03g0411500

Description

Peptidase S14, ClpP family protein

Version

NM_001056884.1 GI:115453496 GeneID:4333096

Length

3448 bp

Definition

Oryza sativa Japonica Group Os03g0411500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:17630235..17633682

Sequence Coding Region

17630290..17630357,17630478..17630512,17631200..17631269,17631410..17631614,17631776..17631841
,17632451..17632591,17632803..17632856,17632992..17633084,17633183..17633230

Expression

GEO Profiles:Os03g0411500

Genome Context

<gbrowseImage1> name=NC_008396:17630235..17633682 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:17630235..17633682 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgcctatggccatctccaccccgctcgccctccgcgcctccccgacccgcctcctctcccgcaggcggagcggagccaaatcaggcgtggctctcccaggtccacaatttgtaccacctggtatttcttcaaagttggacgagaggatacattgtcattcttctctgaggaaaaatacaattgtagcatcagagaatgaaaatccacctttaatgcctgccataatgactcctgctggtgctcttgatctggcaactgtattgttggggaaccgcattatcttcattggtcaatatattaactcgcaagtagcacagcgtgtaatatcacagcttgtcacacttgctgctgttgatgaagaggctgatattctgatctacctgaactgccccggcggaagtctctactccatcttagcaatttatgattgcatgtcctggatcaagcccaaagttggaacagtgtgctttggtgttgttgctagccaggcagcaattatacttgctggcggtgagaagggaatgcgttatgccatgccaaatgctagagtaatgattcatcaacctcaaggtgtatcagagggtaatgtggaggaggtgaggcgacaggttggggaaaccatttatgctcgtgataaagttgataagatgtttgctgcttttactgggcaaaccttggatatggtacaacagtggacagagagggatcgtttcatgtcttcatctgaagccatggactttggactagttgatgccctgctggaaacaagatactaa</cdnaseq>

Protein Sequence

<aaseq>MAPMAISTPLALRASPTRLLSRRRSGAKSGVALPGPQFVPPGIS SKLDERIHCHSSLRKNTIVASENENPPLMPAIMTPAGALDLATVLLGNRIIFIGQYIN SQVAQRVISQLVTLAAVDEEADILIYLNCPGGSLYSILAIYDCMSWIKPKVGTVCFGV VASQAAIILAGGEKGMRYAMPNARVMIHQPQGVSEGNVEEVRRQVGETIYARDKVDKM FAAFTGQTLDMVQQWTERDRFMSSSEAMDFGLVDALLETRY</aaseq>

Gene Sequence

<dnaseqindica>56..123#244..278#966..1035#1176..1380#1542..1607#2217..2357#2569..2622#2758..2850#2949..2996#actcctcagtcctcgcctcggctcggctccctcccacgctccagctccgcctccaatggcgcctatggccatctccaccccgctcgccctccgcgcctccccgacccgcctcctctcccgcaggtgagctccacggaactacaacttccacctccttcgctcgctcgctcgccccgcgcttctctcttcatggattcccccgttcttgtcccctcaccctctgtctggtccttctttcttcaggcggagcggagccaaatcaggcgtggctctcccaggtgagatttcctaacccttggtttagcaaaccatttcccttggtcagctcgttaggccaggactgtttggtggaatttgatcgttgatttgataagctttactgagatgttgtccatggtggtgcacatattagaacatgaccatttgggcagccgtcccatcagctcctagttgtctttctctgtgccaattttttatggagtcgtcattggtaggttttgcaaagcatatagaacctctgaatgtcggcattatccaagagtatgccgacctggggttatctgaaccagtgtcaactccttcctgggccaatgtctggtatgcatcagcattagctcactaagtacacgaaaaatggatgtgcttggttgaacggatatgtataaaaacgataacctgcatataacatatcacctcagtttggtctgattctgaaattagtttagggccttttagcaaactgctgaatgagatttccagactgtatatgtgttattgtgtttgtcagtaactcagtatggtgtattagcacaactcaacatgccataatgacaggatatgcggagcacaaacttttctttggacatgttttttggattcctttactgtttagtccatctgtctttcacatgatatattgctgcaaatgtgctgagttgcattctcactcaaatttccacacctaggtccacaatttgtaccacctggtatttcttcaaagttggacgagaggatacattgtcattcttctctgaggtgatatatttgaaactgtcatgcctgatatacaatgaggatacattgcctgatttgaaactgctcatctaggttttatttgtgctgtgtatcagaatcctgttttattcattcgtaatattgtaaatattttttcacaggaaaaatacaattgtagcatcagagaatgaaaatccacctttaatgcctgccataatgactcctgctggtgctcttgatctggcaactgtattgttggggaaccgcattatcttcattggtcaatatattaactcgcaagtagcacagcgtgtaatatcacagcttgtcacacttgctgctgttgatgaagaggctgatattctggttagtgtttatttttgtgtttttcagatcataacagttaccctattgttcactgcagcagctcttgattgctcaacttcactcccttggcttgctcctttagctcacaggtgtgttgctctatatcttataactccttttgtataattctgttttgccagatctacctgaactgccccggcggaagtctctactccatcttagcaatttatgattgcatgtcctgggtatgccatctatgttgagctactttttccatgtccttcatgcattcaaatttcagagattgtattcacctatatttattcttgtggatgctttctgagttattctcatctaatttaatatttacattgttggatgagaacacattatagatgcatctcaacattttgtatcttccacattatgcatgcccctagctagtgaatttatatttataatatagcacagatatagcatttacaggaaagcctaatgtaatttaggcaaaaattatatctcatatcaatggtagtgcttgcaacatttgtattcttatatttttattgtagtacatactagacatgagcatttgccatgctgagactgtgctaattgggtttggtctggtactgcagacaacagatctcatttcctgaaatcatgcctgtctctaaaactggctttgagctggaccagccttgttagttgttagatttggctgtgtttttacttgttatgccagttttccataaccaaatactttatctacaatttcgcctactgataaataaatcccagaatattaatctttttttgttgttctgcactaacacatgaaccatttattgcagatcaagcccaaagttggaacagtgtgctttggtgttgttgctagccaggcagcaattatacttgctggcggtgagaagggaatgcgttatgccatgccaaatgctagagtaatgattcatcaacctcaaggtgtatcagaggtatgattctggggctttctgcctttctgagttactgcagcgggtgcattatgattttctaacattgtgactacagtaaataataatcatcatcattttagctggccacatgaaacttacaatatacagtcttgctaggacatacttgcttgcctttgtgtttgttgtacttgaagtttgttttttattctaaaaattggatgatttgcagggtaatgtggaggaggtgaggcgacaggttggggaaaccatttatgctcgtgatgtaagtgttttgtgatagataacaagttctatattttcttcagtgtacatttgaattagatgtttgatgagggtaaggaatttctcttgattctgctctctaagcgattaaagcttctgaaaaatctggatgcagaaagttgataagatgtttgctgcttttactgggcaaaccttggatatggtacaacagtggacagagagggatcgtttcatgtcttcatctgaagtaactttcatctcttaaatgtatcagaagaaagtaaatcatcatttgccatgtgaattataacttatttcccccttctttttttggttttaccctaggccatggactttggactagttgatgccctgctggaaacaagatactaacaaacaaacacttaggcacagtttgattagcagaggctggtacaaggattgtgaaactggagctgaagttgagattttcgccgtccttctagttcaaggactccaatgacaggaggctggatctgcgagacttgaatgcatcgccatcgctcctatgagcaaaacatctctgcgttgagtgtgattttttgctcttcttttttggatctggttttacatgccgccagcctatggtctcaatgcattggtcctgctaatgtttagtgtagaccagatgatcctttagacagcaaaacatcagttattactccgtagattttcccatgagctgattccagactgtgtgcaacttttgtgttccaattgcaaagtttgcaacccaacccaacccaacacatgggctgatgggctgttgacaaaggagagattttacacttcacatatgtcaaact</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0411500, RefSeq:Os03g0411500