Difference between revisions of "Os05g0586200"

From RiceWiki
Jump to: navigation, search
(→‎Annotated Information)
Line 1: Line 1:
 
Please input one-sentence summary here.
 
Please input one-sentence summary here.
  
−
==Annotated Information==
+
==Annotated Information[[File:http://ricewiki.big.ac.cn/skins/common/images/button_media.png]]==
 
===Function===
 
===Function===
−
Please input function information here.
+
[[File:Expression.figure1.png|thumb|right|'''Figure1:'''''Gene expression and hormone content in wild type and OsJAR1 TOS17 insertion lines after simulated herbivory (WOS)(frome reference<ref name=ref1/>).'']]
 +
[[File:Expression.figure2.png|thumb|right|'''Figure2:'''''The expression levels of OsJAR1 and OsJAR2 mRNA and the accumulation of JA and JA-amino acid conjugates in response to wounding(from reference<ref name=ref2/>).'']]
 +
OsJAR1 contributes mainly to biosynthesis of the stress-induced jasmonoyl-isoleucine involved in defense responses in rice by the use of an osjar1 Tos17 mutant.<ref name=ref1/><ref name=ref4/>It is involved in phytochrome and jasmonate signalling. In far-red and blue lights, osjar1 coleoptiles were longer if compared with the wild type (WT), indicating that OsJar1participates in the suppression of coleoptile elongation in these light conditions, while the mutant did not show a clear phenotype in red light.OsJar1 modulates light and JA signalling in the photomorphogenesis of rice.<ref name=ref3/> Light can induce jasmonate-isoleucine conjugation via OsJAR1-dependent pathways in rice. OsJAR1 is the most important JA-Ile conjugating enzyme in the wounding response during the vegetative stage.<ref name=ref5/>Plants produce jasmonic acid (JA) and its amino acid conjugate, jasmonoyl‐L‐isoleucine (JA‐Ile) as major defense signals in response to wounding and herbivory. OsJAR1‐deficient plants have strongly reduced JA‐Ile levels after WOS<ref name=ref1/>.
  
 
===Expression===
 
===Expression===
−
Please input expression information here.
+
 
 +
(1)OsJar1 transcripts were up-regulated transiently in response to treatment with exogenous methyl-jasmonic acid (MeJA)<ref name=ref3/>.The expression levels of OsJAR1 and OsJAR2 were induced in response to wounding with the concomitant accumulation of JA-Ile.<ref name=ref2/>
 +
 
 +
(2)Real-time PCR was conducted according to the QuantiTect SYBR Green PCR handbook (Qiagen). PCR was perfomed in ABI PRISM 7000 cycler (PE Applied Biosystems, Warrington, UK) using QuantiTect SYBR green-mastermix with HotStar Taq DNA polymerase following the recommended conditions [15 min 95 °C, 40× (15 s, 94 °C; 30 s, 60 °C; 30 s, 72 °C)]. JAR1F2 and JAR1R2 were used as primers to amplify OsJar1 cDNA, Rubg237F and Rubg304R for ubiquitin, which was used as the endogenous control gene.
 +
 
 +
For RT-PCR, first-strand cDNA synthesis kit for RT-PCR (Roche, Mannheim, Germany) was performed according to the manufacturer's description. A 1 µL aliquot of a 1:10 dilution of the RT product was used as a template in the subsequent PCR reaction. For amplification of OsJAR1 cDNA, the primers JAR1F1 and JAR1R2 were used, for ubiquitin Rubg237F and Rubg 304R. The PCR conditions were 1 min 94 °C, 30× (94 °C, 1 min; 60 °C, 1 min; 72 °C, 2 min), 72 °C, 7 min.<ref name=ref3/>
 +
 
 +
Primers used in real-time PCR and RT-PCR:
 +
 
 +
JAR1F1:     TAAGGCATTACGCAGGGAAC
 +
 
 +
JAR1F2:    AGTGCTGAGCATCAACATCG
 +
 
 +
JAR1R1:     CCAGATAACAGCACCAGAAGC
 +
 
 +
JAR1R2:     CACCACCAAGGCTTAGGAAA
 +
 
 +
Rubg237F:  GAGCCTCTGTTCGTCAAGTA
 +
 
 +
Rubg304R:  ACTCGATGGTCCATTAAACC<ref name=ref3/>
 +
 
  
 
===Evolution===
 
===Evolution===
−
Please input evolution information here.
+
OsJar1 belongs to the GH3 family in rice. Another member of this family in Arabidopsis, DWARF IN LIGHT 2 (DFL2), showed 47% identities. Dfl2 was shown to be a light-dependent gene, but its gene product did not show enzymatic activity on plant hormones, presumably (Takase et al. 2003). OsJAR1 contained three domains described to be important for the enzymatic function of GH3 proteins (Chang, Xiang & Dunaway-Mariano 1997; Staswick et al. 2002; Terol et al. 2006).<ref name=ref3/>
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.

Revision as of 18:08, 18 May 2014

Please input one-sentence summary here.

Annotated InformationFile:Http://ricewiki.big.ac.cn/skins/common/images/button media.png

Function

Figure1:Gene expression and hormone content in wild type and OsJAR1 TOS17 insertion lines after simulated herbivory (WOS)(frome reference[1]).
Figure2:The expression levels of OsJAR1 and OsJAR2 mRNA and the accumulation of JA and JA-amino acid conjugates in response to wounding(from reference[2]).

OsJAR1 contributes mainly to biosynthesis of the stress-induced jasmonoyl-isoleucine involved in defense responses in rice by the use of an osjar1 Tos17 mutant.[1][3]It is involved in phytochrome and jasmonate signalling. In far-red and blue lights, osjar1 coleoptiles were longer if compared with the wild type (WT), indicating that OsJar1participates in the suppression of coleoptile elongation in these light conditions, while the mutant did not show a clear phenotype in red light.OsJar1 modulates light and JA signalling in the photomorphogenesis of rice.[4] Light can induce jasmonate-isoleucine conjugation via OsJAR1-dependent pathways in rice. OsJAR1 is the most important JA-Ile conjugating enzyme in the wounding response during the vegetative stage.[5]Plants produce jasmonic acid (JA) and its amino acid conjugate, jasmonoyl‐L‐isoleucine (JA‐Ile) as major defense signals in response to wounding and herbivory. OsJAR1‐deficient plants have strongly reduced JA‐Ile levels after WOS[1].

Expression

(1)OsJar1 transcripts were up-regulated transiently in response to treatment with exogenous methyl-jasmonic acid (MeJA)[4].The expression levels of OsJAR1 and OsJAR2 were induced in response to wounding with the concomitant accumulation of JA-Ile.[2]

(2)Real-time PCR was conducted according to the QuantiTect SYBR Green PCR handbook (Qiagen). PCR was perfomed in ABI PRISM 7000 cycler (PE Applied Biosystems, Warrington, UK) using QuantiTect SYBR green-mastermix with HotStar Taq DNA polymerase following the recommended conditions [15 min 95 °C, 40× (15 s, 94 °C; 30 s, 60 °C; 30 s, 72 °C)]. JAR1F2 and JAR1R2 were used as primers to amplify OsJar1 cDNA, Rubg237F and Rubg304R for ubiquitin, which was used as the endogenous control gene.

For RT-PCR, first-strand cDNA synthesis kit for RT-PCR (Roche, Mannheim, Germany) was performed according to the manufacturer's description. A 1 µL aliquot of a 1:10 dilution of the RT product was used as a template in the subsequent PCR reaction. For amplification of OsJAR1 cDNA, the primers JAR1F1 and JAR1R2 were used, for ubiquitin Rubg237F and Rubg 304R. The PCR conditions were 1 min 94 °C, 30× (94 °C, 1 min; 60 °C, 1 min; 72 °C, 2 min), 72 °C, 7 min.[4]

Primers used in real-time PCR and RT-PCR:

JAR1F1: TAAGGCATTACGCAGGGAAC

JAR1F2: AGTGCTGAGCATCAACATCG

JAR1R1: CCAGATAACAGCACCAGAAGC

JAR1R2: CACCACCAAGGCTTAGGAAA

Rubg237F: GAGCCTCTGTTCGTCAAGTA

Rubg304R: ACTCGATGGTCCATTAAACC[4]


Evolution

OsJar1 belongs to the GH3 family in rice. Another member of this family in Arabidopsis, DWARF IN LIGHT 2 (DFL2), showed 47% identities. Dfl2 was shown to be a light-dependent gene, but its gene product did not show enzymatic activity on plant hormones, presumably (Takase et al. 2003). OsJAR1 contained three domains described to be important for the enzymatic function of GH3 proteins (Chang, Xiang & Dunaway-Mariano 1997; Staswick et al. 2002; Terol et al. 2006).[4]

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os05g0586200

Description

GH3 auxin-responsive promoter family protein

Version

NM_001062995.1 GI:115465720 GeneID:4339756

Length

5516 bp

Definition

Oryza sativa Japonica Group Os05g0586200, complete gene.

Source

Oryza sativa Japonica Group 

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:29281780..29287295

Sequence Coding Region

29284407..29284687,29284793..29284894,29285094..29285911,29286499..29287043

Expression

GEO Profiles:Os05g0586200

Genome Context

<gbrowseImage1> name=NC_008398:29281780..29287295 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:29281780..29287295 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgacgatctgcagctgtgaggagacgatcaatgagtttgagatgttaacgcgtgatgctgcgcgtgtgcagaaggatacactgaaaaagatccttgagataaatgctagtgctgagtacctgcagaactttgggcttggggggaggactgatgccgagagctacaaatcctgcatcccattgtgtgtgcacaatgatattgagccctatatccagcggattgttgatggcgatacctcaccagtggtcactggagaacccatcaccaacctctctctcagttccggtacaacacacggaaagcccaagttcattccattcaatgatgaattacttgagaccacacttcaaatataccgtacatcttacgcgtttaggaaccgtgaataccctattggccaaggaaaagcactgcagtttgtttatggtagcaagcaagtcataacgaaaggtggcattcttgcaacaactgcgacaacaaacttgtataggagacagcgctataaggaaggcatgaaggatatccagtcgcagtgttgcagtcctgatgaagttatctttggccctgatttccaccaatccttgtactgtcacttgctgtgtgggttaatatactcagaggaggtccattcagtgttctcaacatttgctcacagcctagtccatgcattccaaacattcgaggaggtttgggaagatctatgcactgatataagagacggtgttctctcaaagaaagttacagcaccatcaattcgtgaggctgtttcaaaaatcctgaagcccaatcctgaacttgctgactcaatatacaagaagtgtattggtttgagcaattggtatggagtgatcccagcactgtggccaaatgcaaagtatgtgtatggtatcatgacaggatccatggagccatatctgaaaaaattaaggcattacgcagggaacttgccacttataagtgctgactatggcgcatcggaaggatgggttggctctaacatagaccctactgtgccaccagagcaggtgacatatgctgttctcccacaagttggttattttgagttcattcctttggagaaaccaataggggaggagacagaaaactccgcctccattcattacatagaatcagatccagttggcttgactgaagttgaggtcggcaaaatctatgaagttgtaataactaactttgcaggtctatatcggtacaggctaggagatgtcgtgaagatagcacgcttccacaactccacacctgagctccaattcatctgtcgcagaagcctagtgctgagcatcaacatcgacaagaacaccgagaaagacctccagttggctgttgaggaggcatcaaagttcctggaaggagagaagctcgaagtcatggatttcacgagcttcgtggaacgatcaagcgatccagggcgctacgtgatcttctgggagctgagtggcgatgcgagtgatgaggtcttgagcagctgcgcaaatgccttggatctagccttcattgacgcaggctacacgggctcgaggaagatcaagacgatcggcccccttgagctccggatcctcagaaagggaaccttcaaggagatcctagatcatttcctaagccttggtggtgcggtgagccagttcaagacaccaaggtttgtgaacccatcaaacagcaaggtgttgcagatactgagtagaaatgtcacccaaagttatttcagtactgcctatggattttga</cdnaseq>

Protein Sequence

<aaseq>MTICSCEETINEFEMLTRDAARVQKDTLKKILEINASAEYLQNF GLGGRTDAESYKSCIPLCVHNDIEPYIQRIVDGDTSPVVTGEPITNLSLSSGTTHGKP KFIPFNDELLETTLQIYRTSYAFRNREYPIGQGKALQFVYGSKQVITKGGILATTATT NLYRRQRYKEGMKDIQSQCCSPDEVIFGPDFHQSLYCHLLCGLIYSEEVHSVFSTFAH SLVHAFQTFEEVWEDLCTDIRDGVLSKKVTAPSIREAVSKILKPNPELADSIYKKCIG LSNWYGVIPALWPNAKYVYGIMTGSMEPYLKKLRHYAGNLPLISADYGASEGWVGSNI DPTVPPEQVTYAVLPQVGYFEFIPLEKPIGEETENSASIHYIESDPVGLTEVEVGKIY EVVITNFAGLYRYRLGDVVKIARFHNSTPELQFICRRSLVLSINIDKNTEKDLQLAVE EASKFLEGEKLEVMDFTSFVERSSDPGRYVIFWELSGDASDEVLSSCANALDLAFIDA GYTGSRKIKTIGPLELRILRKGTFKEILDHFLSLGGAVSQFKTPRFVNPSNSKVLQIL SRNVTQSYFSTAYGF</aaseq>

Gene Sequence

<dnaseqindica>2628..2908#3014..3115#3315..4132#4720..5264#acccgctctctcctctcatctcctcctcctgtgttcgtgttcttcttcttcttgtagcagcgcttaaccaacccatcattagcgaccaaacctctctccctctccccctctgactaatcaaaattaaacaatttcgatctccaccttcctcttcttgattccagttccaccagagagagacagggtcttctctaatccatgtggtgcttgttggtctcgcttgcttcgtcttcgtcttcgtcttcctcttctcgcacctagtcccgcctcgtcgcctcctccggagaccggagccggacgggacggttgccggcgagcggcggtcgctttcttctctcggccctactcacggtcagtgattggctcccttccttcctggtgttctattgatcctttgtgggggaaaaaaggcttcgatttggggggcatgttcttgcctttttcctgttttgggggagacgagacggatttcaatatatttttttaatctggggggattatgtgtggaaaagattgttcctcgtttatctgggtagtatttggagggtcctatggggatattctttgtaaagctgggatttttaggtggtaaaataatgttgatatactttcagaaagaatatactgcagaaagtttttcagagataacagataagattaggccgtccttaatctcctttctttgcgtctgttccctccaactaggatggaaaagaatggcggattgattagtcagaaactggctgctgaatactctgagatttcatttcatttcagcctctgttgattcctcatggctgtctctaacttctttgcttgtgcttccgatttctttggcggtaaatagcctccacgaatctctggtcaacgaggtattaaaacttaaaagggcttttgtctcaggttgacccgagccatgattcgcccccctcccatgctttgcaaacaagatatgatacgcagtgctggtacaattcagagcatatgttctttcctcttttgctttgtttcagacagcaacttttagcagccacgcctctcacaagttgataaaaaaaaattttgtgttgctctcctactactcatcactttctagtgcgatatagtagtagtagtagtaggagtatatgctagcactatccacagtttagcacacagattggtggcacctgggcagatataaaagcttcacatttttatcaatgtctgcgcagttatattgtcgatttgattccttttatagatattactaggtcaagtcgtgtcgcaattactccccccctttcctccattgtagggtgttcctgtttagtccgcgggggatgctgctccctgagcctgtgtgtgtctcttgatttttctttctttgctcgcacgcagcagcagcagcatgttttgtgtcggtgttaaggaccctacataaataattcatcaaatcaagtatcttttgtctgttttggggaatctcctttgcggttcgtccaaaatttcgcgaaagaaacaattctatatgactgcttttgtcgagaggttagacatcactgctagagtagtagagcaatgctacacgtactaaatttttcttactaaacttttactaataatcatctcaaccgtttgatttaagtagatggaatttacaaaaaatctagatgcactcgtagcatgacacatcagtgttagtaagaatttagtaagaaaaagttagtacgtatagccttttccagagtagtactagcagagtgttagattgtatcacctgctcgggcagttgtaaatggtatggtgagttggtgactggtttttacagttttttcatacttgggtttatggaggatttactgttatggagacctgtaaaaaatgttacatatattgctactttctcatttggatttcggatggctgttttttttatcattatgttggtaaagttttgcatcaagaatctgaaccagcttagcaatactaatagtagatggttcagtaagctgcttccatgtccttgcaactttgcaatgctggcaattttttttcgaaaaagagcaaggctggcaatatgtgtatagcttttgtttggcaatatatgttgcgattctagcgctggtggtatctcaagatcagaaaaagtgagcatcaatgtcttactttattggttttctgactgattacattagtaaacgctgtgtccaaaagtatagagtaatactagttatattttcttaattgtcagtgactcagtatccgcagatggtttgtaaagtgcccttatttttcatggtcgttagctttagtaggtatatagtgtactcttgatggtttatcctttttttcgcccctttctcctttgtcatctgggcgcacgttgctatgcagtttcatgagatggttagtgcgtatccaactattctgtcggcaataaagttccacaatcttcaaaattttctaccattctgatgccaactcctactgcactatcagctcttggtttccagctcagttagtggttagaaattgcagcctacatgaaaaagtaactaatagattttctcgtctccaccttttatagttattttcagtgactcttcttccaaaccaagtggtaaagccaggattctaccattacaatgacgatctgcagctgtgaggagacgatcaatgagtttgagatgttaacgcgtgatgctgcgcgtgtgcagaaggatacactgaaaaagatccttgagataaatgctagtgctgagtacctgcagaactttgggcttggggggaggactgatgccgagagctacaaatcctgcatcccattgtgtgtgcacaatgatattgagccctatatccagcggattgttgatggcgatacctcaccagtggtcactggagaacccatcaccaacctctctctcaggtactgtacccattgcttgaaatttgtcaccttattatgcttatcgtttactagtttatgataataaatgttcatagtctggcttcttctgtggctttcatacagttccggtacaacacacggaaagcccaagttcattccattcaatgatgaattacttgagaccacacttcaaatataccgtacatcttacgcgtttaggaaccggtaaggatctctgatttattattatttatgctcaagtaatgctgctttttctgaatgttcaacaaactttgatgatcaggttcaacatgagttattgtttttatacactgttttgcatgctattaacttgttgcttctttgtgtattttttactctgcatcccagaatattagaataaccttctgttttgtgtttacagtgaataccctattggccaaggaaaagcactgcagtttgtttatggtagcaagcaagtcataacgaaaggtggcattcttgcaacaactgcgacaacaaacttgtataggagacagcgctataaggaaggcatgaaggatatccagtcgcagtgttgcagtcctgatgaagttatctttggccctgatttccaccaatccttgtactgtcacttgctgtgtgggttaatatactcagaggaggtccattcagtgttctcaacatttgctcacagcctagtccatgcattccaaacattcgaggaggtttgggaagatctatgcactgatataagagacggtgttctctcaaagaaagttacagcaccatcaattcgtgaggctgtttcaaaaatcctgaagcccaatcctgaacttgctgactcaatatacaagaagtgtattggtttgagcaattggtatggagtgatcccagcactgtggccaaatgcaaagtatgtgtatggtatcatgacaggatccatggagccatatctgaaaaaattaaggcattacgcagggaacttgccacttataagtgctgactatggcgcatcggaaggatgggttggctctaacatagaccctactgtgccaccagagcaggtgacatatgctgttctcccacaagttggttattttgagttcattcctttggagaaaccaataggggaggagacagaaaactccgcctccattcattacatagaatcagatccagttggcttgactgaagttgaggtcggcaaaatctatgaagttgtaataactaactttgcaggtatattctctcttttctatctattctgaatcttaaattgggttaaatctccattatctagaagtatagcaatgaaaattctacaaaaagcaaggggcagccatccctagttctgcttctggtgctgttatctggtcagacatgataccaacgggatttatcagaaataactagataagtttgtgtgacatattatttcaaaaaagaaatatttattagtcttgccccttcaatcttaaacctctttttgacaagagctccttattatgtaaaaaacataaaaatcacacggttgcaatgtatacatcaatattattaagcacatgggggagtaattattgtgaatgtttgtggtccactccttgaactctttgctgcttactcattatgattatcttaaaactctatcagatgatatatgtttctttttgtgtatgccaaccatgccagactcaccaataacatttttattctttaatatctctggctaacatacaattattttgttttaggacacagaaagtttacttattacggtgatgtttaagaaacactaaaatctttttcttttttctattttgttctaggtctatatcggtacaggctaggagatgtcgtgaagatagcacgcttccacaactccacacctgagctccaattcatctgtcgcagaagcctagtgctgagcatcaacatcgacaagaacaccgagaaagacctccagttggctgttgaggaggcatcaaagttcctggaaggagagaagctcgaagtcatggatttcacgagcttcgtggaacgatcaagcgatccagggcgctacgtgatcttctgggagctgagtggcgatgcgagtgatgaggtcttgagcagctgcgcaaatgccttggatctagccttcattgacgcaggctacacgggctcgaggaagatcaagacgatcggcccccttgagctccggatcctcagaaagggaaccttcaaggagatcctagatcatttcctaagccttggtggtgcggtgagccagttcaagacaccaaggtttgtgaacccatcaaacagcaaggtgttgcagatactgagtagaaatgtcacccaaagttatttcagtactgcctatggattttgatacaaagaaacatattagatgctagcagctgcatgtaattacctttttacctcttgtttttcagctttactgtagtctccaccggaagaaaacgtttggtttagtctcttgaataatctattttcttatcctgtttgtgactatctagaatctatgtaaatggcccagctctagtgaaagttatggtgatgttatcaggaaagaaaatgtggtgtttcccgtaacaagtgctgcaaagtattattcagactc</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0586200, RefSeq:Os05g0586200

  1. ↑ 1.0 1.1 1.2 Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. ↑ 2.0 2.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref4
  4. ↑ 4.0 4.1 4.2 4.3 4.4 Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  5. ↑ Cite error: Invalid <ref> tag; no text was provided for refs named ref5
Retrieved from "https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os05g0586200&oldid=169563"