Difference between revisions of "Os06g0110000"

From RiceWiki
Jump to: navigation, search
(References)
Line 8: Line 8:
 
===Mutation===
 
===Mutation===
 
To identify genes involved in the control of rice tillering, Ishikawa et al. analyzed d3, d7, d10, d14, d27 tillering dwarf mutants exhibit reduction of plant stature and an increase in tiller numbers, in the mutants, axillary meristems are normally established but the suppression of tiller bud activity is weakened[1,3]. All mutants exhibited a similar abnormal appearance from the early stage of development, we can the this phenomena from figure 1.Yan et al found that darkness-induced senescence or H2O2-induced cell death in the thisd leaf [as measured by chlorophyll degradation, membrane ion leakage and expression of senescence-associated genes(SAGs)] in a d3 rice mutant was dalayed compared to that in its reference line Shiokari[2], we can see the leaf senescence phenomenon from the figure 2.In addition,Yasuno et al.compare the phenotype of the d3rcn1 double mutant with each single mutant and parental rice cultivar‘‘Shiokari’’, The reduction in tillering by the rcn1 mutation was independent of the d3 genotype, and tillering number of d3rcn1 double mutant was between those of the d3 and rcn1 mutants. The phenotypes of the 4 genotypes at heading time are shown in Figure 3.These results demonstrated that the Rcn1 gene was not involved in the D3-associated pathway in tillering control[3].
 
To identify genes involved in the control of rice tillering, Ishikawa et al. analyzed d3, d7, d10, d14, d27 tillering dwarf mutants exhibit reduction of plant stature and an increase in tiller numbers, in the mutants, axillary meristems are normally established but the suppression of tiller bud activity is weakened[1,3]. All mutants exhibited a similar abnormal appearance from the early stage of development, we can the this phenomena from figure 1.Yan et al found that darkness-induced senescence or H2O2-induced cell death in the thisd leaf [as measured by chlorophyll degradation, membrane ion leakage and expression of senescence-associated genes(SAGs)] in a d3 rice mutant was dalayed compared to that in its reference line Shiokari[2], we can see the leaf senescence phenomenon from the figure 2.In addition,Yasuno et al.compare the phenotype of the d3rcn1 double mutant with each single mutant and parental rice cultivar‘‘Shiokari’’, The reduction in tillering by the rcn1 mutation was independent of the d3 genotype, and tillering number of d3rcn1 double mutant was between those of the d3 and rcn1 mutants. The phenotypes of the 4 genotypes at heading time are shown in Figure 3.These results demonstrated that the Rcn1 gene was not involved in the D3-associated pathway in tillering control[3].
 +
 +
[[File:Figure3.jpg]]
  
 
===Expression===
 
===Expression===

Revision as of 09:00, 19 May 2014

Please input one-sentence summary here.

Annotated Information

Function

In the case of the rice plant, more tillering equates to more grain-bearing branches, hence a higher grain yield.The D3 gene plays an important role in the control of tiller bud dormancy to suppress bud activity, encoding an F-box leucine-trich-repeat protein orthologous to Arabidopsis MAX2/ORE9[1]. Besides, the d3 protein is also involved in darkness-induced senescence or H2O2-induced cell death in the plant leaves[2].

Mutation

To identify genes involved in the control of rice tillering, Ishikawa et al. analyzed d3, d7, d10, d14, d27 tillering dwarf mutants exhibit reduction of plant stature and an increase in tiller numbers, in the mutants, axillary meristems are normally established but the suppression of tiller bud activity is weakened[1,3]. All mutants exhibited a similar abnormal appearance from the early stage of development, we can the this phenomena from figure 1.Yan et al found that darkness-induced senescence or H2O2-induced cell death in the thisd leaf [as measured by chlorophyll degradation, membrane ion leakage and expression of senescence-associated genes(SAGs)] in a d3 rice mutant was dalayed compared to that in its reference line Shiokari[2], we can see the leaf senescence phenomenon from the figure 2.In addition,Yasuno et al.compare the phenotype of the d3rcn1 double mutant with each single mutant and parental rice cultivar‘‘Shiokari’’, The reduction in tillering by the rcn1 mutation was independent of the d3 genotype, and tillering number of d3rcn1 double mutant was between those of the d3 and rcn1 mutants. The phenotypes of the 4 genotypes at heading time are shown in Figure 3.These results demonstrated that the Rcn1 gene was not involved in the D3-associated pathway in tillering control[3].

Figure3.jpg

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

(1) Graduate School of Agriculture and Life Sciences, University of Tokyo, 1-1-1 Yayoi, Bunkyo, Tokyo, 113-8657 Japan

(2)CREST, Japan Science and Technology Corporation, 4-1-8 Honcho, Kawaguchi, Saitama, 332-0012 Japan

(3) Research Institute for Bioresources, Okayama University,2-20-1Chuo, Kurashiki, Okayama, 710-0046 Japan

(4) Faculty of Agriculture, Hokkaido University, Sapporo, 060 Japan

(5) Department of Crop Science Obihiro University of Agriculture and Veterinary Medicine, Nishi 2-5 Inada-cho,Obihiro, Hokkaido, 080-8555 Japan

(6) Graduate School of Agriculture, Hokkaido University, Kita 9 Nishi 9, Kita-ku, Sapporo, Hokkaido, 060-8589 Japan

References

[1] Ishikawa S, Maekawa M, Arite T, Onishi K, Takamure I,Kyozuka J. Suppression of tiller bud activity in tillering dwarf mutants of rice[J]. Plant and Cell Physiology, 2005, 46(1): 79-86.

[2] Yasuno N, Yasui Y, Takamure I, Kato K. Genetic interaction between 2 tillering genes, reduced culm number 1 (rcn1) and tillering dwarf gene d3, in rice [J]. Journal of heredity, 2007, 98(2): 169-172.

[3] Yan H, Saika H, Maekawa M, Takamure I, Tsutsumi N,Kyozuka J, Nakazono M. Rice tillering dwarf mutant dwarf3 has increased leaf longevity during darkness-induced senescence or hydrogen peroxide-induced cell death[J]. Genes & genetic systems, 2007, 82(4): 361-366.

Structured Information

Gene Name

Os06g0110000

Description

Similar to DWARF3 (Fragment)

Version

NM_001063114.1 GI:115465959 GeneID:4339885

Length

5774 bp

Definition

Oryza sativa Japonica Group Os06g0110000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:579671..585444

Sequence Coding Region

579736..580004,582676..583426,583535..583624,584130..584208,584387..584493
,584619..584740,585003..585105

Expression

GEO Profiles:Os06g0110000

Genome Context

<gbrowseImage1> name=NC_008399:579671..585444 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:579671..585444 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggtgatggagggcatgggcatggcggcggcgtgggcggcgggggacctgtgggtgctggcggcggcggtggtggccggcgtggtgctggtcgacgcggtggtgcggagggcgcacgactgggttcgcgtggcggcgctgggggcggagaggaggtcgaggttgccgccgggggagatggggtggccgatggtgggcagcatgtgggcgttcctccgcgccttcaagtccggcaaccccgacgccttcatcgcctccttcatccgacggtttgggcggacaggggtgtacaggacgttcatgttcagcagcccgacgatcctggcggtgacgccggaggcgtgcaagcaggtgctcatggacgacgagggcttcgtcaccggctggcccaaggccaccgtcaccctcatcggccccaaatccttcgtcaacatgtcctacgacgaccaccgccgcatccgcaagctcaccgccgcccccatcaacggcttcgacgccctcaccacctacctctccttcatcgaccagaccgtcgtcgcctccctccgccgctggtcctcgccggagtccggccaggtcgagttcctcaccgagctcaggcgcatgaccttcaagatcatcgtccagatcttcatgagcggcgccgacgacgccaccatggaggccctggagcggagctacaccgacctcaactacggcatgcgcgccatggccatcaacctccccggcttcgcctactaccgcgcgctcagggctcgccggaagctcgtgtccgtgctgcagggtgtgctcgacggccggagggccgccgccgccaagggcttcaaacgctccggggccatggacatgatggaccgcctcatcgaggccgaggacgaacgcggccgccgcctcgccgacgacgagatcgtcgacgtcctcatcatgtacctcaacgccggccacgagtcctccggccacatcaccatgtgggccaccgtcttcctccaggagaaccccgacatcttcgcaagagcaaaggctgagcaagaggagatcatgagaagcattccagcaacgcagaacggattaaccctcagggacttcaagaagatgcacttcctctcacaggttgtcgacgagacacttcgctgcgtcaacatctccttcgtgtccttccgtcaggccacaagagacatctttgtgaacggttatcttatccccaaggggtggaaggttcagctgtggtacagaagtgtgcacatggatgaccaagtttatcctgaccccaaaatgttcaacccttcaagatgggagggaccccctccgaaagccggaacattccttccatttggactgggagcaagactgtgccctggaaatgatcttgcaaagctggagatctctgtcttcctccatcattttctcctgggttacaagctgaagagggcaaatccaaagtgcagggtgagatatctgcctcatccccggcctgtggacaactgcttggcgacgatcaccaaagtttccgatgaacactaa</cdnaseq>

Protein Sequence

<aaseq>MVMEGMGMAAAWAAGDLWVLAAAVVAGVVLVDAVVRRAHDWVRV AALGAERRSRLPPGEMGWPMVGSMWAFLRAFKSGNPDAFIASFIRRFGRTGVYRTFMF SSPTILAVTPEACKQVLMDDEGFVTGWPKATVTLIGPKSFVNMSYDDHRRIRKLTAAP INGFDALTTYLSFIDQTVVASLRRWSSPESGQVEFLTELRRMTFKIIVQIFMSGADDA TMEALERSYTDLNYGMRAMAINLPGFAYYRALRARRKLVSVLQGVLDGRRAAAAKGFK RSGAMDMMDRLIEAEDERGRRLADDEIVDVLIMYLNAGHESSGHITMWATVFLQENPD IFARAKAEQEEIMRSIPATQNGLTLRDFKKMHFLSQVVDETLRCVNISFVSFRQATRD IFVNGYLIPKGWKVQLWYRSVHMDDQVYPDPKMFNPSRWEGPPPKAGTFLPFGLGARL CPGNDLAKLEISVFLHHFLLGYKLKRANPKCRVRYLPHPRPVDNCLATITKVSDEH</aaseq>

Gene Sequence

<dnaseqindica>66..334#3006..3756#3865..3954#4460..4538#4717..4823#4949..5070#5333..5435#actcgtctctgcgtgcgtttcgttccttcgttgcgttgcgttggttcatcgatagatcgttctcgatggtgatggagggcatgggcatggcggcggcgtgggcggcgggggacctgtgggtgctggcggcggcggtggtggccggcgtggtgctggtcgacgcggtggtgcggagggcgcacgactgggttcgcgtggcggcgctgggggcggagaggaggtcgaggttgccgccgggggagatggggtggccgatggtgggcagcatgtgggcgttcctccgcgccttcaagtccggcaaccccgacgccttcatcgcctccttcatccgacggtcagtactaacatactcccctcctcctgccacgtgtcactggtggggtccacaccaatgctgacttgtgggccccaccggtgatcgatccttctttttttttttttgctctctttttcatcatatatgcacgtatacatgcataaagaaagaagtgatcttaattattcattcatctcaagaaattaaagaatgagaacacacacatctgcagagtgatcttttgatgcaagtgtgatctttgaatctctttgatcgccgcaacttggatcgaatcccacatatataaacgcagaatttcaattggtggtgtgcgtgagagagagatttggttgggtttggtttggtttggctgaccctggaaatgaaacccatcgagatgttgttatgatcgggaatttaggggttgttcagattaatgatattttaattggtaaagttgttaaaaatgtatatctatttagttttttttataaaactttggtaaatatataagaaatcctgtcaaaacttggtaatattgtcaaattgtaaaaattttgacaatgccaaaatttggtaatgtttgttttagttataatctgaacagccccttaatatggatccatactccatttgatttcaataagattgtggatggatggacggatcatggatgggttgctttttaatttatgtaaacatcaaaagatgctccccttttgaatggtactactgctagtatgatatagcgttgttgcaatgcatgatccatctatcagaccctagcatcaaggcatggtacttctttttctttttcttttcttttctttttgcactaggatgctcttcttctaccttttcatcatcatacctgatatgctgccctgccctggcctgttgtcaaaacccataccgatgtgtttttctcgcagcaataaaaatatattatgccttttattttatttatttttcacctttatgaacttgcatgcatatcttcatatccttcaaaacggtcctgttaaatattcatgttgatatgtctgaatcattgaccaaacacactcctgaaaagaaatcactagctaataagtatagctattactcctagaaaaccccatcctgttgtaaaaacagcaaaccatgggatatttgatggctttatgccatgtactattctgctgagtgatgtctaagcatttttggctcagattaggaattgtcggcacagctttatttgtacaagaattgacagcaattgatgctaatgtggtaggctcacgagaattcacagccagataaacgtacgagctagttttagccagtcattaggttgctgacaccgaaatgaaaattttgtggcacccactgtccatcatcagatttccaccactccagatatgcaacaacatattccaattttgccgaacaaagtttcaggacaaaaatctctttcggtgctttgctaaatagttaatacactgcttgctgatctcttgttgcatatatttactgttaagacaaattcggtgggcataactaggcatgcattagcttttgtttaatctgctatatatgccatgggaatcaatatcatatagctaggtgaaaacaaagcacccagtgctttccaaattagtatatgtgcgcttcaccctgattgtcgtttagtcaaacgtaatctcccacactcggattgatttggtgtccttttattgcttgtcttatgcactgattatcttaatcgctgttaaaaagatggttacacgtgttgttcatagattaatgccttctgttctgaaagatgcaacaatgtgttgcctttttgtcaagaaagataacacaaatgaggcacaagtagaaagattgttgcaagatcagttcttcagatttgcataggaaaaatgtttgtcatgtctgtaccattgtctgcatcacagcaaaatgacttttgtctcttcattcacttatctcagtatatttcttctgcatatatactagagtactagtttcagtaacaaagaactcatctgttaaaaaaaatcacttctttttgtgtgtgtgtgttcaagttgctctaatttatggcaactgaaacaagagactgatatcactggaacatcagcagcttaattcagaagttataacaaataaagttgtaatagtacattcatagcgaatgaagtgatggaatgaaacagaaatgctattaatcacaatcaaatcggaactaaaaatatgcaaacttatggtgatttggaagcatgggaatgcaaagaatggcaggtttgctctaatttctgacaactgaaacaagagttgacactgaaaacaagatcactgatcgttgtgatcacaaagtagtactccctccgtttcaaaatatttgacactgttgactttttagcatatgtttgaccgttcgtcttattcaaaaacttttgtgagatatgtaaaattatatgtccacataaaaatatatttaacaatgaatcaaatgataggaaaagaattaataattacttaaattttttaaataagacgaacggtcaaacatgtgtaaaaagtcaacgacgtcaaatatttcgaaacggagggagtagcaaatattgtagcacattgatagtaatcaaaagagaaacaaaaagaagaatgggaatttgatggtaagcatggaagaatggcacaggtttgggcggacaggggtgtacaggacgttcatgttcagcagcccgacgatcctggcggtgacgccggaggcgtgcaagcaggtgctcatggacgacgagggcttcgtcaccggctggcccaaggccaccgtcaccctcatcggccccaaatccttcgtcaacatgtcctacgacgaccaccgccgcatccgcaagctcaccgccgcccccatcaacggcttcgacgccctcaccacctacctctccttcatcgaccagaccgtcgtcgcctccctccgccgctggtcctcgccggagtccggccaggtcgagttcctcaccgagctcaggcgcatgaccttcaagatcatcgtccagatcttcatgagcggcgccgacgacgccaccatggaggccctggagcggagctacaccgacctcaactacggcatgcgcgccatggccatcaacctccccggcttcgcctactaccgcgcgctcagggctcgccggaagctcgtgtccgtgctgcagggtgtgctcgacggccggagggccgccgccgccaagggcttcaaacgctccggggccatggacatgatggaccgcctcatcgaggccgaggacgaacgcggccgccgcctcgccgacgacgagatcgtcgacgtcctcatcatgtacctcaacgccggccacgagtcctccggccacatcaccatgtgggccaccgtcttcctccaggagaaccccgacatcttcgcaagagcaaaggtcactcctcactctgcttctttttttttcctgtcactccaaatttggtttcaatcatctgaacttttgcattatttgaaattttgcatgatttgattttgagttcaggctgagcaagaggagatcatgagaagcattccagcaacgcagaacggattaaccctcagggacttcaagaagatgcacttcctctcacaggtataatataataatatatatagggaaactctattcatttcttaaagcgatatctccttgtttttttatgaaatttaaaaagtcattaacttttttaaaaaaattagtatgatatatcaacatatgatatgttacttcataaacatacatattcaaattcaacttatacaagtagaaacaaaaataacaaatttgatggatagaacgcgtaattcattgtcaaatttgttatttttgtttcgaattgtatatgtcgaattttaacttgcatgtttgtaaaaagatatatcatatattcatctaccttgacaaagttttttaaattttttgataacttttttgaacgccatgcacaaaacgagaggatgtccactcgagggacaaaaatccacttccatatatgcaaatgatttttaacacagtggaatatactactgctccagccgaattaccacagtaattactgcataactaatttgcacgctaatgatgatgaaatctgaaggttgtcgacgagacacttcgctgcgtcaacatctccttcgtgtccttccgtcaggccacaagagacatctttgtgaacggtgcgttttcacatagctgaaaatccatcccttaaagacatatcagaatcatcatcatctgaattctgattgatgttgttgtttctctagtgaaccacatcgactgattactactagtgcttgaaatgaaatgaaaatgaatgaatgaatgttatactaaccaagaagaacccagcaggttatcttatccccaaggggtggaaggttcagctgtggtacagaagtgtgcacatggatgaccaagtttatcctgaccccaaaatgttcaacccttcaagatgggaggtaaattaaattcaatccattcttctgcagtttttgtttcttcatcaaactagattaagctccatcgattctctgcctttttcagtgtgtttcaatggtcgatgtaattttttttgttctttcagggaccccctccgaaagccggaacattccttccatttggactgggagcaagactgtgccctggaaatgatcttgcaaagctggagatctctgtcttcctccatcattttctcctgggttacaagtaaacctcctctcaacatatttatgacaaaaaaaactactgttaactgaacatgattaattgtgaacagataaaagactaactgctgcacctctcttcttcttttcagtctttatttcttctactcttttcatttcattatcagtttacttgtagcttccaggatcaaaactgaaagttatgcctttcagaataccaactccaaaaaggataaaattgctttgttcaaagttcaaaactgaaagttgtctgctgtgtgcaggctgaagagggcaaatccaaagtgcagggtgagatatctgcctcatccccggcctgtggacaactgcttggcgacgatcaccaaagtttccgatgaacactaaaagttcagggattctttagctggaaccgaaaacagccaggctaggctacttgttcctctgggacaagtaaataaacatgattataaagtatatcacgtactctggaagaaaaaaaagagagagaagtgatgtgtattcgtcttgatatgctcgctttggtttcgcattgttcttgtttgtcctagcttaggacaaagattaaagtaaagcagttcgagttatactaacaagcttcctgaatatgggaaacacgcaagcattccccttcttttctatctatccacctcactgaatttggattgttctttatcagttaataaagatggcacgaaaagttgc</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0110000, RefSeq:Os06g0110000