Difference between revisions of "Os02g0649900"

From RiceWiki
Jump to: navigation, search
Line 3: Line 3:
 
===Function===
 
===Function===
 
OsYSL2 is an Fe-regulated metal-NA transporter that is involved in phloem transport and the translocation of mineral nutrients in grains<ref name="ref1" />. The altered expression of OsYSL2changes the localization of Fe, and that OsYSL2 is a critical Fe-nicotianamine transporter important for Fe translocation,especially in the shoots and endosperm <ref name="ref2" />.
 
OsYSL2 is an Fe-regulated metal-NA transporter that is involved in phloem transport and the translocation of mineral nutrients in grains<ref name="ref1" />. The altered expression of OsYSL2changes the localization of Fe, and that OsYSL2 is a critical Fe-nicotianamine transporter important for Fe translocation,especially in the shoots and endosperm <ref name="ref2" />.
 +
 
Based on the nucleotide sequence,OsYSL2 was predicted to encode a polypeptide of 674 amino acids containing 14 putative transmembrane domains<ref name="ref1" />. Cells expressing the OsYSL2–GFP fusion protein showed a signal in the plasma membrane, with the presence of the putative transmembrane domains shows that OsYSL2 is a transporter that is localized in the plasma membrane<ref name="ref1" />.
 
Based on the nucleotide sequence,OsYSL2 was predicted to encode a polypeptide of 674 amino acids containing 14 putative transmembrane domains<ref name="ref1" />. Cells expressing the OsYSL2–GFP fusion protein showed a signal in the plasma membrane, with the presence of the putative transmembrane domains shows that OsYSL2 is a transporter that is localized in the plasma membrane<ref name="ref1" />.
  
 
===Mutant===
 
===Mutant===
 
*Yasuhiro Ishimaru et al. produced OsYSL2 knock-down lines using the RNAi method. Seven independent lines were generated, and the expression of endogenous OsYSL2 in T1OsYSL2i leaves of lines 3 and 5 was suppressed, as revealed by northern blot analysis (Figure 1a) . Fe concentrations in the seeds were also decreased in lines 3 and 5,consistent with the suppression of OsYSL2(Figure 1b).At the early growth stage, the growth of line 5 was impaired compared with the WT, when grown under Fe-sufficient conditions. These growth defects appeared to be more significant when grown under Fe-deficient conditions (Figure 2c–e)<ref name="ref2" />.
 
*Yasuhiro Ishimaru et al. produced OsYSL2 knock-down lines using the RNAi method. Seven independent lines were generated, and the expression of endogenous OsYSL2 in T1OsYSL2i leaves of lines 3 and 5 was suppressed, as revealed by northern blot analysis (Figure 1a) . Fe concentrations in the seeds were also decreased in lines 3 and 5,consistent with the suppression of OsYSL2(Figure 1b).At the early growth stage, the growth of line 5 was impaired compared with the WT, when grown under Fe-sufficient conditions. These growth defects appeared to be more significant when grown under Fe-deficient conditions (Figure 2c–e)<ref name="ref2" />.
 +
  
 
*Yasuhiro Ishimaru et al. assessed whether the over expression of OsYSL2(OXOsYSL2) in rice plants could enhance Fe accumulation in the seeds. Constitutive over expression of OsYSL2 decreased the Fe concentration in the brown rice and shoots ,although the Fe concentration was higher in the roots of OXOsYSL2 plants. On the other hand, the Mn concentration was increased in the brown rice and decreased in the roots of OXOsYSL2 plants<ref name="ref2" />.  
 
*Yasuhiro Ishimaru et al. assessed whether the over expression of OsYSL2(OXOsYSL2) in rice plants could enhance Fe accumulation in the seeds. Constitutive over expression of OsYSL2 decreased the Fe concentration in the brown rice and shoots ,although the Fe concentration was higher in the roots of OXOsYSL2 plants. On the other hand, the Mn concentration was increased in the brown rice and decreased in the roots of OXOsYSL2 plants<ref name="ref2" />.  

Revision as of 13:16, 19 May 2014

OsYSL2 was reported by researchers from Japan as a rice metal-NA transporter that is responsible for the phloem transport of iron and manganese, including the translocation of iron and manganese into the grain.

Annotated Information

Function

OsYSL2 is an Fe-regulated metal-NA transporter that is involved in phloem transport and the translocation of mineral nutrients in grains[1]. The altered expression of OsYSL2changes the localization of Fe, and that OsYSL2 is a critical Fe-nicotianamine transporter important for Fe translocation,especially in the shoots and endosperm [2].

Based on the nucleotide sequence,OsYSL2 was predicted to encode a polypeptide of 674 amino acids containing 14 putative transmembrane domains[1]. Cells expressing the OsYSL2–GFP fusion protein showed a signal in the plasma membrane, with the presence of the putative transmembrane domains shows that OsYSL2 is a transporter that is localized in the plasma membrane[1].

Mutant

  • Yasuhiro Ishimaru et al. produced OsYSL2 knock-down lines using the RNAi method. Seven independent lines were generated, and the expression of endogenous OsYSL2 in T1OsYSL2i leaves of lines 3 and 5 was suppressed, as revealed by northern blot analysis (Figure 1a) . Fe concentrations in the seeds were also decreased in lines 3 and 5,consistent with the suppression of OsYSL2(Figure 1b).At the early growth stage, the growth of line 5 was impaired compared with the WT, when grown under Fe-sufficient conditions. These growth defects appeared to be more significant when grown under Fe-deficient conditions (Figure 2c–e)[2].


  • Yasuhiro Ishimaru et al. assessed whether the over expression of OsYSL2(OXOsYSL2) in rice plants could enhance Fe accumulation in the seeds. Constitutive over expression of OsYSL2 decreased the Fe concentration in the brown rice and shoots ,although the Fe concentration was higher in the roots of OXOsYSL2 plants. On the other hand, the Mn concentration was increased in the brown rice and decreased in the roots of OXOsYSL2 plants[2].

Expression

  • OsYSL2 was of particular interest because no detectable transcripts were present in the roots of either Fe-sufficient or Fe-deficient plants, but dramatic expression was induced in the leaves of Fe-deficient plants[1].Research by Yasuhiro Ishimaru et al. showed that the high expression of OsYSL2 in the roots under Fe deficiency was not consistent with previous study[2].
  • The cell-type specificity of OsYSL2 expression was investigated using promoter (1.5 kb):b-glucuronidase (GUS) analysis.GUS staining was observed in phloem cells of the vascular bundles of leaves and leaf sheaths of Fe-sufficient rice(Figure 2e–g). The phloem-specific expression of the OsYSL2 promoter suggested that OsYSL2 is involved in the phloem transport of Fe [1]. OsYSL2 is expressed during reproductive development in rice. RT-PCR analysis confirmed that OsYSL2 transcripts were increased during early seed development[1].
  • In fully mature seeds,strong OsYSL2 expression was observed in the epithelium, the vascular bundle of the scutellum, and the leaf primordium . Two days after sowing, the OsYSL2 expression level increased in the scutellum near the endosperm. Three days after sowing,OsYSL2 expression was observed in the bran and coleoptile[3].

Evolution

YS1-like genes in rice Our search for YS1homologues in the Oryza sativaL. Ssp. japonica (cv. Nipponbare) rice genomic database identified 18 putative OsYSL that exhibited 36–76% sequence similarity to YS1 (Figure 3)[1].

Labs working on this gene

  • Graduate School of Agricultural and Life Sciences, The University of Tokyo, 1-1-1 Yayoi, Bunkyo-ku, Tokyo 113-8657, Japan
  • Core Research for Evolutional Science and Technology (CREST), Japan Science and Technology Corporation, Kawaguchi 332-0012, Japan
  • National Agricultural Research Center, 1-2-1 Inada, Joetsu, Niigata 943-0193, Japan

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 Koike S, Inoue H, Mizuno D, et al. OsYSL2 is a rice metal‐nicotianamine transporter that is regulated by iron and expressed in the phloem[J]. The Plant Journal, 2004, 39(3): 415-424.PMID 15255870
  2. 2.0 2.1 2.2 2.3 Ishimaru Y, Masuda H, Bashir K, et al. Rice metal‐nicotianamine transporter, OsYSL2, is required for the long‐distance transport of iron and manganese[J]. The Plant Journal, 2010, 62(3): 379-390.PMID 20128878
  3. Nozoye T, Inoue H, Takahashi M, et al. The expression of iron homeostasis-related genes during rice germination[J]. Plant molecular biology, 2007, 64(1-2): 35-47.PMID 17333504

Structured Information

Gene Name

Os02g0649900

Description

Similar to Iron-phytosiderophore transporter protein yellow stripe 1

Version

NM_001054121.2 GI:297599682 GeneID:4330161

Length

3302 bp

Definition

Oryza sativa Japonica Group Os02g0649900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:27058478..27061779

Sequence Coding Region

27058478..27059406,27059491..27059605,27059697..27059886,27059990..27060124,27060204..27060301
,27061115..27061287,27061395..27061779

Expression

GEO Profiles:Os02g0649900

Genome Context

<gbrowseImage1> name=NC_008395:27058478..27061779 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:27058478..27061779 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggaagccgccgctcccgagatagagaggtgcgacgccggcgacgtggagtcggaccacgacggcgccgccgccgccgccgagcgcgtgccgccgtggcgcgagcaggtgacggcgcggggcatggtggcggcgctgctcatcggattcgtctacaccgtcatcatcatgaagctggcgctcaccacggggatcatccccacgctcaacgtctccgccgcgctcctcgccttcctcgcgctccgcggctggacgcgcgcgcccgccctcctcctccccggcggcggcgccgcctcctcctcctcccggcgccgccccttcacccgccaggagaacaccgttgtccagacctgcgccgtcgcctgctacaccatgggattcggcggtgggttcgggtcgtcgctgctggctctgaacaggaagacgtacgagttggccggggtgagcacgccgggcaactcgccggggagctacaaggagcccggggtcgggtggatgaccggattcctgtttgcgattagcttcgttgggctccttaacttgcttccactcagaaaggctttgatcatagattataagttaacctatccaagtgggactgcaactgctgttcttataaacggattccatacccctcaaggagaaaatagtgcaaagaagcaagtccgcggatttctgaattgctttgggatcagcctcttatggagcttcttccagtggttctacactggtggagagagttgtgggtttcttcaattccctacctttggtctaaaggcttggaaacaaacgttctattttgatttcagcctcacatatgttggtgcgggaatgatctgctcacaccttgtaaacctctccgcgctctttggcgcaatactttcttgggggataatgtggccactgatcagcatacaaaagggtaagtggtatcctggaaatgttcctgaaagcagcatgacaagcttgtttggttacaagtccttcatgtgtgtagctttgatcatgggggatggcctttaccacttcataaaagtaacaggtatcactgctaagagcctgcatgaacgatccaatcgtagacatgctaagaaagcgacagatgaggatacatttgtaattgctgatatgcagcgtgacgagttcttcaacaaagactatattccaaactggctagcgtatgctggatatgccttactgagcattgttgcggtaattgcgatacccataatgttccaacaggtgaagtggtactatgttgttgtagcctttgtgcttgctcctgtgctgggattctccaatgcctatggaactgggctaactgacatgaacatgagctacaactatggcaagattgctctcttcatctttgcagcttggggagggagggacaacggtgtcattgctggtcttgttggttgtggaatagtgaagcagctagtacaagtctctgctgatttgatgcacgactttaagactggtcatctgacattaacatcaccaagatccatgcttgttgggcaggccattggtacagccatgggctgcataatcgctccactgactttcttgctcttctacaaagcatttgatattgggaaccctgatggatactggaaggctccatatgccctgatatttcgaaacatggccattcttggcgtcgagggcttttctgcactaccaaagcattgtcttgagctgtctgctggcttctttgcattttctgtgctcatcaaccttatgagggacttcttgccacgcaagtacagggattatgtgcccctgccgacggcaatggctgtgccattccttgttggtgcaaattttgctattgacatgtgtgtgggaagcctgatagtctttgcctggcacaagatcaacagcaaggagtctgcgttgctagtgccagcggttgcgtctggttttatttgtggagatggtatatggatgttcccttcttccctgctttcccttgctaaggttaagccaccaatctgcatgaagttcactcccggaagctag</cdnaseq>

Protein Sequence

<aaseq>MEAAAPEIERCDAGDVESDHDGAAAAAERVPPWREQVTARGMVA ALLIGFVYTVIIMKLALTTGIIPTLNVSAALLAFLALRGWTRAPALLLPGGGAASSSS RRRPFTRQENTVVQTCAVACYTMGFGGGFGSSLLALNRKTYELAGVSTPGNSPGSYKE PGVGWMTGFLFAISFVGLLNLLPLRKALIIDYKLTYPSGTATAVLINGFHTPQGENSA KKQVRGFLNCFGISLLWSFFQWFYTGGESCGFLQFPTFGLKAWKQTFYFDFSLTYVGA GMICSHLVNLSALFGAILSWGIMWPLISIQKGKWYPGNVPESSMTSLFGYKSFMCVAL IMGDGLYHFIKVTGITAKSLHERSNRRHAKKATDEDTFVIADMQRDEFFNKDYIPNWL AYAGYALLSIVAVIAIPIMFQQVKWYYVVVAFVLAPVLGFSNAYGTGLTDMNMSYNYG KIALFIFAAWGGRDNGVIAGLVGCGIVKQLVQVSADLMHDFKTGHLTLTSPRSMLVGQ AIGTAMGCIIAPLTFLLFYKAFDIGNPDGYWKAPYALIFRNMAILGVEGFSALPKHCL ELSAGFFAFSVLINLMRDFLPRKYRDYVPLPTAMAVPFLVGANFAIDMCVGSLIVFAW HKINSKESALLVPAVASGFICGDGIWMFPSSLLSLAKVKPPICMKFTPGS</aaseq>

Gene Sequence

<dnaseqindica>2374..3302#2175..2289#1894..2083#1656..1790#1479..1576#493..665#1..385#atggaagccgccgctcccgagatagagaggtgcgacgccggcgacgtggagtcggaccacgacggcgccgccgccgccgccgagcgcgtgccgccgtggcgcgagcaggtgacggcgcggggcatggtggcggcgctgctcatcggattcgtctacaccgtcatcatcatgaagctggcgctcaccacggggatcatccccacgctcaacgtctccgccgcgctcctcgccttcctcgcgctccgcggctggacgcgcgcgcccgccctcctcctccccggcggcggcgccgcctcctcctcctcccggcgccgccccttcacccgccaggagaacaccgttgtccagacctgcgccgtcgcctgctacaccatgggattcggcggtgcgcgccccgctactacttcctgtttgatttctctccccaagtctttcttaatttgttcttgcgatggcgcctgtatataaaattgggggatatcgtgcgcgcaggtgggttcgggtcgtcgctgctggctctgaacaggaagacgtacgagttggccggggtgagcacgccgggcaactcgccggggagctacaaggagcccggggtcgggtggatgaccggattcctgtttgcgattagcttcgttgggctccttaacttgcttccactcagaaaggtgtgtactttgcccacaatttttgttccgttggtactgaatatgcaatggattaaattagacctgtccctgcaaattcaggactctctggagttcctgctattatgttcgttaattgttgtgatttgctatctttcagtgaactgtttttttctctcagttttgtttcggatttttggagaatatagctcagttgttgcatgtgaaatctgtgctatattctcagttttgtgctgatattaaaaattgtgaactcactcctattttaagatgatattttacataaacaatctgttgttacatttgtaaatttgtctgatcccagtatacggataggtcatgttttcaagaaagactaggaagtttaagttacccatcagtctaccactatctgttttactttgttaggttcttgatctgctttatcttgctaacctttaaggctttaactagaactacttgttcagactccagagtaatgcacatcgtgtgcatggcatggaaacccaactaacctgcaacagttcaacaccaattgggagttctacatagtacacatcctaatatttggtatgcggcattacatttccattatccttaaccaacaagttgactaaagtgctaaaacgaaatgaacttttttgagacaaataaaatgtcatagactaaatgagacaactgtacacacgaattccctctagatactcttcttcaagtctaaaaaatttgtcattacaatctgtagtttgaagacagaaaccagttttctttgcatttgtctgtcccacctaatgatgtgcatgacgttttcaggctttgatcatagattataagttaacctatccaagtgggactgcaactgctgttcttataaacggattccatacccctcaaggagaaaatagtgcaaagtatggtccaggtctcacttgtgctaaatacatcatcgcagttcgtgatatgaattattaattctacttttcatgccaggaagcaagtccgcggatttctgaattgctttgggatcagcctcttatggagcttcttccagtggttctacactggtggagagagttgtgggtttcttcaattccctacctttggtctaaaggcttggaaacaaacgtatgcattattggtcacccattgtttgtacccctactttatgcataattgcatattcgtcaggcagccagattctcctaactaccaattttttttgctgcaggttctattttgatttcagcctcacatatgttggtgcgggaatgatctgctcacaccttgtaaacctctccgcgctctttggcgcaatactttcttgggggataatgtggccactgatcagcatacaaaagggtaagtggtatcctggaaatgttcctgaaagcagcatgacaagcttgtttggttacaaggtcaggcatacaatttacctttttctcaaaatagtctgatgtgaatccataattttatatggtacagtatctctaattttctccttctcagtccttcatgtgtgtagctttgatcatgggggatggcctttaccacttcataaaagtaacaggtatcactgctaagagcctgcatgaacgatccaatcgtagacatgctaagaaaggtaaacgtgctctgcgaaattaactatttccacgttttcttccctcttatatcaccaaggtagctgaagctgagtgaattgcagcgacagatgaggatacatttgtaattgctgatatgcagcgtgacgagttcttcaacaaagactatattccaaactggctagcgtatgctggatatgccttactgagcattgttgcggtaattgcgatacccataatgttccaacaggtgaagtggtactatgttgttgtagcctttgtgcttgctcctgtgctgggattctccaatgcctatggaactgggctaactgacatgaacatgagctacaactatggcaagattgctctcttcatctttgcagcttggggagggagggacaacggtgtcattgctggtcttgttggttgtggaatagtgaagcagctagtacaagtctctgctgatttgatgcacgactttaagactggtcatctgacattaacatcaccaagatccatgcttgttgggcaggccattggtacagccatgggctgcataatcgctccactgactttcttgctcttctacaaagcatttgatattgggaaccctgatggatactggaaggctccatatgccctgatatttcgaaacatggccattcttggcgtcgagggcttttctgcactaccaaagcattgtcttgagctgtctgctggcttctttgcattttctgtgctcatcaaccttatgagggacttcttgccacgcaagtacagggattatgtgcccctgccgacggcaatggctgtgccattccttgttggtgcaaattttgctattgacatgtgtgtgggaagcctgatagtctttgcctggcacaagatcaacagcaaggagtctgcgttgctagtgccagcggttgcgtctggttttatttgtggagatggtatatggatgttcccttcttccctgctttcccttgctaaggttaagccaccaatctgcatgaagttcactcccggaagctag</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0649900, RefSeq:Os02g0649900