Difference between revisions of "Os06g0622700"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 21: Line 21:
 
suggested that the Os06g0622700 bZIP transcription factor
 
suggested that the Os06g0622700 bZIP transcription factor
 
plays a critical role in the induction of chaperone genes.[[during maturation was significantly higher than that of wildtype.
 
plays a critical role in the induction of chaperone genes.[[during maturation was significantly higher than that of wildtype.
[[File:lzh1.png|200px|thumb|left|替换文字]]
+
[[File:lzh1.png|200px|thumb|left|RT-PCR expression profile of a rice
 +
bZIP transcription factor containing a TMD.
 +
(a) Expression during seed development.
 +
(b) Expression under ER stress conditions in
 +
callus.
 +
(c) Induction of GUS activity by T2 callus containing
 +
the Os06g0622700 promoter:GUS construct
 +
after treatment with 2 mM DTT for 6 h. The
 +
photographs on the bottom left show GUSstained
 +
calli with or without DTT treatment (scale
 +
bars = 1 mm). The bottom right panel shows
 +
quantitative measurement of GUS activity in
 +
these calli [4-methylumbelliferone (4-MU) production
 +
rate over 1 h].]]
  
 
===Expression===
 
===Expression===

Revision as of 15:06, 19 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Os06g0622700 is a homolog of ATbZIP60. Expression profiles of these transcription factors obtained by microarray analyses showed that expression of Os06g0622700 was 1.9-fold enhanced by suppression of BiP1 and 3.3-fold enhanced by over-expression of BiP1 compared to wild-type. RT-PCR analysis of Os06g0622700 expression in these transgenic rice seeds at 14 DAF also supported this result. As shown in Figure 6(a), the transcript abundance of Os06g0622700 in these transgenic seeds during maturation was significantly higher than that of wildtype. Furthermore, transcript levels of Os06g0622700 in rice calli were increased by treatment with DTT or tunicamycin (Figure 1b and c). By contrast, transcript levels of the other two bZIPs exhibited little difference between these transgenic lines and wild-type rice. Treatment of calli with DTT or tunicamycin also led to no significant change in expression of the two bZIPs (Figure 1b). These results suggested that the Os06g0622700 bZIP transcription factor plays a critical role in the induction of chaperone genes.[[during maturation was significantly higher than that of wildtype.

RT-PCR expression profile of a rice bZIP transcription factor containing a TMD. (a) Expression during seed development. (b) Expression under ER stress conditions in callus. (c) Induction of GUS activity by T2 callus containing the Os06g0622700 promoter:GUS construct after treatment with 2 mM DTT for 6 h. The photographs on the bottom left show GUSstained calli with or without DTT treatment (scale bars = 1 mm). The bottom right panel shows quantitative measurement of GUS activity in these calli [4-methylumbelliferone (4-MU) production rate over 1 h].

Expression

Please input expression information here.

Evolution

Os06g0622700 is a homolog of ATbZIP60.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os06g0622700

Description

Eukaryotic transcription factor, DNA-binding domain containing protein

Version

NM_001064635.1 GI:115469001 GeneID:4341554

Length

1991 bp

Definition

Oryza sativa Japonica Group Os06g0622700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:25918948..25920938

Sequence Coding Region

25918979..25919418,25919822..25920042,25920504..25920757

Expression

GEO Profiles:Os06g0622700

Genome Context

<gbrowseImage1> name=NC_008399:25918948..25920938 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:25918948..25920938 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggatgtagagttcttcgccgacctcgacctcgacgcgctcctcgcctccttctcctcctccgccgccgccgccggctccggcgtctcgggcctcttcgccccgtcaccgccgcacgatgcggaggcggggtcgccggagtcggtgagctcccggcggcccagcccttcccgggaggcggcgctgtcggagatcgagaggttcctgatggaggagggccccgcggcggaggagggggtcggcgcggaggatttcttcgacgcgctgctcgtcgacggcggggaggaggaggaggaagaagaggggaaggggagtgaggcggggggaagcacggatggggattccgggaaggagaatgaggtggctaccccggacgcggagaaggaggatgtggaggcggaggtggatggcgatgatcccatgagcaagaagaagaggaggcagatgagaaatagggattctgccatgaaatcgagggagaggaagaagatgtatgttaaggacctagagactaagagcaagtatctagaggccgagtgtcgtcgcctcagctacgcgcttcagtgctgcgcagctgagaacatggcgctgcgccagagcttgttgaaggataggcctgtcggtgccgccacagccatgcaggagtctgccgtactcacggaaaccctgccgctggtttccctgctttggctcgtgagcatcgtgtgcctactcccggtgcccggtctacccaaccgaaacccggtggctcgaagcagcgccggaagagatctcgcgacggtaaccggaaagaagacaagcagtgaacaacagctagaagaaacattactactccatgggaggcgttgcaagggctcgagggcgaggatcaagctagataccggaccgttccgtttagcagcagctgcttgctag</cdnaseq>

Protein Sequence

<aaseq>MDVEFFADLDLDALLASFSSSAAAAGSGVSGLFAPSPPHDAEAG SPESVSSRRPSPSREAALSEIERFLMEEGPAAEEGVGAEDFFDALLVDGGEEEEEEEG KGSEAGGSTDGDSGKENEVATPDAEKEDVEAEVDGDDPMSKKKRRQMRNRDSAMKSRE RKKMYVKDLETKSKYLEAECRRLSYALQCCAAENMALRQSLLKDRPVGAATAMQESAV LTETLPLVSLLWLVSIVCLLPVPGLPNRNPVARSSAGRDLATVTGKKTSSEQQLEETL LLHGRRCKGSRARIKLDTGPFRLAAAAC</aaseq>

Gene Sequence

<dnaseqindica>32..471#875..1095#1557..1810#gagagacaaaaatatctccatcgcgatctccatggatgtagagttcttcgccgacctcgacctcgacgcgctcctcgcctccttctcctcctccgccgccgccgccggctccggcgtctcgggcctcttcgccccgtcaccgccgcacgatgcggaggcggggtcgccggagtcggtgagctcccggcggcccagcccttcccgggaggcggcgctgtcggagatcgagaggttcctgatggaggagggccccgcggcggaggagggggtcggcgcggaggatttcttcgacgcgctgctcgtcgacggcggggaggaggaggaggaagaagaggggaaggggagtgaggcggggggaagcacggatggggattccgggaaggagaatgaggtggctaccccggacgcggagaaggaggatgtggaggcggaggtggatggcgatgatcccatgagcaagaagaagaggaggtatgtatgaattgcctaaaaacttgggatttctaaaaatcagggggatttcgtgtgtacaaagatttgtgaatttacataggtagctaggaataatggtcaggttttagttcaacacaattgatcttattcagtgagtgccagaagtccagaaccgcactacacccatagtacattttttttattaattaaaacattatatatgtacatacatgagtatatgatctaatttgtcgtaataagatgcatggtctttttagtgctaatcctttgtgaaattgtaagaaattgctaggctttcaattataagagtgtatggtcttttcaactataagatgttttccgtaatcaaagatgttctagttagacaataatctaatagtatgtgttatgaatttatcaggcagatgagaaatagggattctgccatgaaatcgagggagaggaagaagatgtatgttaaggacctagagactaagagcaagtatctagaggccgagtgtcgtcgcctcagctacgcgcttcagtgctgcgcagctgagaacatggcgctgcgccagagcttgttgaaggataggcctgtcggtgccgccacagccatgcaggagtctgccgtactcacgggtaagacatatcgacaacattttctgtttcatacttctatttcgacatggatgaacaaatcttttcttgccgatcattttgaattgctcagtatgctgacaaacttgtgcttggcatcaatatattcggtgtggtctcatggatgatccgcctaagctaatttttgttgaattcccatgaaatcaaacagctagctattgtagttatagccaattgttgactacattttctgtgtacaagtatgcgtggtttatgcacaaatctgcattgtttatacaataacacttgcttagccttttgttttccaactttggacctaatcagtcaccgaccgaagttgacattaactggaacatggtttctttgctatcctacagtatgcttgagtcataatcctgatgctcctacagtatatttgtgtcataaacctgatgctaaaggtaaccttttcctgtttgcagaaaccctgccgctggtttccctgctttggctcgtgagcatcgtgtgcctactcccggtgcccggtctacccaaccgaaacccggtggctcgaagcagcgccggaagagatctcgcgacggtaaccggaaagaagacaagcagtgaacaacagctagaagaaacattactactccatgggaggcgttgcaagggctcgagggcgaggatcaagctagataccggaccgttccgtttagcagcagctgcttgctaggctgccgcttccttgcaaagttgtttccagtctgtattgtagctagcaaatcaaattggcgtgtctatcgcctgtcgtgctgccgcttatccatggactatctttttctttttttggttccttccccccttgtttttataatatcctcctatgcataatgcattatccaggtagttttgaa</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0622700, RefSeq:Os06g0622700