Difference between revisions of "Os06g0622700"

From RiceWiki
Jump to: navigation, search
(→‎Function)
(→‎Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
−
Os06g0622700 is a homolog of ATbZIP60. Expression profiles of these transcription factors
+
Os06g0622700 is a homolog of ATbZIP60. The Os06g0622700 bZIP transcription factor
−
obtained by microarray analyses showed that expression of
 
−
Os06g0622700 was 1.9-fold enhanced by suppression of
 
−
BiP1 and 3.3-fold enhanced by over-expression of BiP1
 
−
compared to wild-type. RT-PCR analysis of Os06g0622700
 
−
expression in these transgenic rice seeds at 14 DAF also
 
−
supported this result. As shown in Figure 6(a), the transcript
 
−
abundance of Os06g0622700 in these transgenic seeds
 
−
during maturation was significantly higher than that of wildtype.
 
−
Furthermore, transcript levels of Os06g0622700 in rice
 
−
calli were increased by treatment with DTT or tunicamycin
 
−
(Figure 1b and c). By contrast, transcript levels of
 
−
the other two bZIPs exhibited little difference between these
 
−
transgenic lines and wild-type rice. Treatment of calli with
 
−
DTT or tunicamycin also led to no significant change in
 
−
expression of the two bZIPs (Figure 1b). These results
 
−
suggested that the Os06g0622700 bZIP transcription factor
 
 
plays a critical role in the induction of chaperone genes.[[during maturation was significantly higher than that of wildtype.
 
plays a critical role in the induction of chaperone genes.[[during maturation was significantly higher than that of wildtype.
 
[[File:lzh1.png|200px|thumb|left|RT-PCR expression profile of a rice
 
[[File:lzh1.png|200px|thumb|left|RT-PCR expression profile of a rice
Line 35: Line 19:
 
these calli [4-methylumbelliferone (4-MU) production
 
these calli [4-methylumbelliferone (4-MU) production
 
rate over 1 h].]]
 
rate over 1 h].]]
 +
 +
Os06g0622700 is one of the most important transcription
 +
factors involved in signal transduction of the ER stress
 +
response in rice.[[File:lzh2.png]]
  
 
===Expression===
 
===Expression===

Revision as of 15:13, 19 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Os06g0622700 is a homolog of ATbZIP60. The Os06g0622700 bZIP transcription factor plays a critical role in the induction of chaperone genes.[[during maturation was significantly higher than that of wildtype.

RT-PCR expression profile of a rice bZIP transcription factor containing a TMD. (a) Expression during seed development. (b) Expression under ER stress conditions in callus. (c) Induction of GUS activity by T2 callus containing the Os06g0622700 promoter:GUS construct after treatment with 2 mM DTT for 6 h. The photographs on the bottom left show GUSstained calli with or without DTT treatment (scale bars = 1 mm). The bottom right panel shows quantitative measurement of GUS activity in these calli [4-methylumbelliferone (4-MU) production rate over 1 h].

Os06g0622700 is one of the most important transcription factors involved in signal transduction of the ER stress response in rice.Lzh2.png

Expression

Please input expression information here.

Evolution

Os06g0622700 is a homolog of ATbZIP60.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os06g0622700

Description

Eukaryotic transcription factor, DNA-binding domain containing protein

Version

NM_001064635.1 GI:115469001 GeneID:4341554

Length

1991 bp

Definition

Oryza sativa Japonica Group Os06g0622700, complete gene.

Source

Oryza sativa Japonica Group 

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:25918948..25920938

Sequence Coding Region

25918979..25919418,25919822..25920042,25920504..25920757

Expression

GEO Profiles:Os06g0622700

Genome Context

<gbrowseImage1> name=NC_008399:25918948..25920938 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:25918948..25920938 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggatgtagagttcttcgccgacctcgacctcgacgcgctcctcgcctccttctcctcctccgccgccgccgccggctccggcgtctcgggcctcttcgccccgtcaccgccgcacgatgcggaggcggggtcgccggagtcggtgagctcccggcggcccagcccttcccgggaggcggcgctgtcggagatcgagaggttcctgatggaggagggccccgcggcggaggagggggtcggcgcggaggatttcttcgacgcgctgctcgtcgacggcggggaggaggaggaggaagaagaggggaaggggagtgaggcggggggaagcacggatggggattccgggaaggagaatgaggtggctaccccggacgcggagaaggaggatgtggaggcggaggtggatggcgatgatcccatgagcaagaagaagaggaggcagatgagaaatagggattctgccatgaaatcgagggagaggaagaagatgtatgttaaggacctagagactaagagcaagtatctagaggccgagtgtcgtcgcctcagctacgcgcttcagtgctgcgcagctgagaacatggcgctgcgccagagcttgttgaaggataggcctgtcggtgccgccacagccatgcaggagtctgccgtactcacggaaaccctgccgctggtttccctgctttggctcgtgagcatcgtgtgcctactcccggtgcccggtctacccaaccgaaacccggtggctcgaagcagcgccggaagagatctcgcgacggtaaccggaaagaagacaagcagtgaacaacagctagaagaaacattactactccatgggaggcgttgcaagggctcgagggcgaggatcaagctagataccggaccgttccgtttagcagcagctgcttgctag</cdnaseq>

Protein Sequence

<aaseq>MDVEFFADLDLDALLASFSSSAAAAGSGVSGLFAPSPPHDAEAG SPESVSSRRPSPSREAALSEIERFLMEEGPAAEEGVGAEDFFDALLVDGGEEEEEEEG KGSEAGGSTDGDSGKENEVATPDAEKEDVEAEVDGDDPMSKKKRRQMRNRDSAMKSRE RKKMYVKDLETKSKYLEAECRRLSYALQCCAAENMALRQSLLKDRPVGAATAMQESAV LTETLPLVSLLWLVSIVCLLPVPGLPNRNPVARSSAGRDLATVTGKKTSSEQQLEETL LLHGRRCKGSRARIKLDTGPFRLAAAAC</aaseq>

Gene Sequence

<dnaseqindica>32..471#875..1095#1557..1810#gagagacaaaaatatctccatcgcgatctccatggatgtagagttcttcgccgacctcgacctcgacgcgctcctcgcctccttctcctcctccgccgccgccgccggctccggcgtctcgggcctcttcgccccgtcaccgccgcacgatgcggaggcggggtcgccggagtcggtgagctcccggcggcccagcccttcccgggaggcggcgctgtcggagatcgagaggttcctgatggaggagggccccgcggcggaggagggggtcggcgcggaggatttcttcgacgcgctgctcgtcgacggcggggaggaggaggaggaagaagaggggaaggggagtgaggcggggggaagcacggatggggattccgggaaggagaatgaggtggctaccccggacgcggagaaggaggatgtggaggcggaggtggatggcgatgatcccatgagcaagaagaagaggaggtatgtatgaattgcctaaaaacttgggatttctaaaaatcagggggatttcgtgtgtacaaagatttgtgaatttacataggtagctaggaataatggtcaggttttagttcaacacaattgatcttattcagtgagtgccagaagtccagaaccgcactacacccatagtacattttttttattaattaaaacattatatatgtacatacatgagtatatgatctaatttgtcgtaataagatgcatggtctttttagtgctaatcctttgtgaaattgtaagaaattgctaggctttcaattataagagtgtatggtcttttcaactataagatgttttccgtaatcaaagatgttctagttagacaataatctaatagtatgtgttatgaatttatcaggcagatgagaaatagggattctgccatgaaatcgagggagaggaagaagatgtatgttaaggacctagagactaagagcaagtatctagaggccgagtgtcgtcgcctcagctacgcgcttcagtgctgcgcagctgagaacatggcgctgcgccagagcttgttgaaggataggcctgtcggtgccgccacagccatgcaggagtctgccgtactcacgggtaagacatatcgacaacattttctgtttcatacttctatttcgacatggatgaacaaatcttttcttgccgatcattttgaattgctcagtatgctgacaaacttgtgcttggcatcaatatattcggtgtggtctcatggatgatccgcctaagctaatttttgttgaattcccatgaaatcaaacagctagctattgtagttatagccaattgttgactacattttctgtgtacaagtatgcgtggtttatgcacaaatctgcattgtttatacaataacacttgcttagccttttgttttccaactttggacctaatcagtcaccgaccgaagttgacattaactggaacatggtttctttgctatcctacagtatgcttgagtcataatcctgatgctcctacagtatatttgtgtcataaacctgatgctaaaggtaaccttttcctgtttgcagaaaccctgccgctggtttccctgctttggctcgtgagcatcgtgtgcctactcccggtgcccggtctacccaaccgaaacccggtggctcgaagcagcgccggaagagatctcgcgacggtaaccggaaagaagacaagcagtgaacaacagctagaagaaacattactactccatgggaggcgttgcaagggctcgagggcgaggatcaagctagataccggaccgttccgtttagcagcagctgcttgctaggctgccgcttccttgcaaagttgtttccagtctgtattgtagctagcaaatcaaattggcgtgtctatcgcctgtcgtgctgccgcttatccatggactatctttttctttttttggttccttccccccttgtttttataatatcctcctatgcataatgcattatccaggtagttttgaa</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0622700, RefSeq:Os06g0622700

Retrieved from "https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os06g0622700&oldid=169815"