Difference between revisions of "Os06g0622700"
Li150706345 (talk | contribs) (→Function) |
Li150706345 (talk | contribs) (→Evolution) |
||
| Line 59: | Line 59: | ||
===Evolution=== | ===Evolution=== | ||
| − | Os06g0622700 is a homolog of ATbZIP60. | + | *Os06g0622700 is a homolog of ATbZIP60. |
| − | Os03g0102200 is a 14.5-kD | + | |
| + | *Os03g0102200 is a 14.5-kD | ||
polypeptide that is similar to DNA-directed RNA | polypeptide that is similar to DNA-directed RNA | ||
polymerase II, SDRP, while | polymerase II, SDRP, while | ||
| Line 69: | Line 70: | ||
we renamed it OsbZIP60. | we renamed it OsbZIP60. | ||
| − | [[File:lzh3.png|200px|thumb| | + | |
| + | [[File:lzh3.png|200px|thumb|right|Figure3.Structure of ZmbZIP17, and the alignment and phylogenetic tree generated with ER stress-associated membrane-associated bZIP | ||
factors from Arabidopsis, rice and maize.]] | factors from Arabidopsis, rice and maize.]] | ||
| − | Figure3:(a) Structure of ZmbZIP17 and ZmbZIP17�C. The map of the full-length ZmbZIP17 indicates the | + | |
| + | *Figure3:(a) Structure of ZmbZIP17 and ZmbZIP17�C. The map of the full-length ZmbZIP17 indicates the | ||
location of the putative bZIP, nuclear localization signal (NLS), transmembrane domains (TMDs) and the canonical S1P site. The map of the | location of the putative bZIP, nuclear localization signal (NLS), transmembrane domains (TMDs) and the canonical S1P site. The map of the | ||
truncated protein ZmbZIP17�C indicates the deletion of TMDs and S1P domains. (b) Alignment of protein sequences for ZmbZIP17 and | truncated protein ZmbZIP17�C indicates the deletion of TMDs and S1P domains. (b) Alignment of protein sequences for ZmbZIP17 and | ||
Revision as of 16:29, 19 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
- Os06g0622700 is a homolog of ATbZIP60. The Os06g0622700 bZIP transcription factor
plays a critical role in the induction of chaperone genes.[[during maturation was significantly higher than that of wildtype.
- Figure1:(a) Expression during seed development.
(b) Expression under ER stress conditions in callus. (c) Induction of GUS activity by T2 callus containing the Os06g0622700 promoter:GUS construct after treatment with 2 mM DTT for 6 h. The photographs on the bottom left show GUSstained calli with or without DTT treatment (scale bars = 1 mm). The bottom right panel shows quantitative measurement of GUS activity in these calli [4-methylumbelliferone (4-MU) production rate over 1 h]
- Os06g0622700 is one of the most important transcription
factors involved in signal transduction of the ER stress response in rice.
- Figure2:(a) Effector, reporter and control vector constructs are shown.
Os06g0622700DC is the active form of the protein. (b) Fold change in GUS activity after transient expression.
- The early stage of the ER stress response in rice is mediated
by OsbZIP50 (Os06g0622700), OsbZIP39 (Os05g0411300) and OsbZIP60 (Os07g0644100).
Expression
- Expression of many chaperone genes induced
by the major BiP1 may be mainly mediated by binding of Os06g0622700 to UPRE or ERSE cis-elements, as expression ofmanychaperone genes induced byDTTtreatmentwasalso regulated by the Os06g0622700 bZIP transcription factor.
- The Os06g0622700
as well as several protein folding-related genes that are regulated by OsbZIP50, such as Os08g0197700 (BiP paralog) and Os11g0197700 (PDI like 1-1) (Wakasa et al. 2011).
Evolution
- Os06g0622700 is a homolog of ATbZIP60.
- Os03g0102200 is a 14.5-kD
polypeptide that is similar to DNA-directed RNA polymerase II, SDRP, while Os06g0622700 is a bZIP (for basic Leu zipper) transcription factor that shows the highest homology to AtbZIP60 in Arabidopsis (Supplemental Fig. S6), so we renamed it OsbZIP60.
- Figure3:(a) Structure of ZmbZIP17 and ZmbZIP17�C. The map of the full-length ZmbZIP17 indicates the
location of the putative bZIP, nuclear localization signal (NLS), transmembrane domains (TMDs) and the canonical S1P site. The map of the truncated protein ZmbZIP17�C indicates the deletion of TMDs and S1P domains. (b) Alignment of protein sequences for ZmbZIP17 and the known membrane-associated bZIP transcription factors. (c) The unrooted phylogenetic tree of ER stress-associated bZIP factors from Arabidopsis, rice and maize. The bZIP factors in (b) and (c) were AtbZIP17 (At2g40950), AtbZIP49 (At3g56660), AtbZIP28 (At2g17770), AtbZIP60 (AT1G42990), OsbZIP39 (Os05g34050), OsbZIP50 (Os06g0622700), OsbZIP60 (Os07g44950), ZmbZIP17 (BT040011), ZmbZIP28 (BT067808) and ZmbZIP60 (BT086464).
Labs working on this gene
Please input related labs here.
References
Hayashi, Shimpei, Takahashi, Hideyuki, Wakasa, Yuhya, Kawakatsu, Taiji, & Takaiwa, Fumio. (2013). Identification of acis-element that mediates multiple pathways of the endoplasmic reticulum stress response in rice. The Plant Journal, 74(2), 248-257. doi: 10.1111/tpj.12117
Hu, J., Zhou, J., Peng, X., Xu, H., Liu, C., Du, B., . . . He, G. (2011). The Bphi008a Gene Interacts with the Ethylene Pathway and Transcriptionally Regulates MAPK Genes in the Response of Rice to Brown Planthopper Feeding. Plant Physiology, 156(2), 856-872. doi: 10.1104/pp.111.174334
Lu, S. J., Yang, Z. T., Sun, L., Sun, L., Song, Z. T., & Liu, J. X. (2012). Conservation of IRE1-regulated bZIP74 mRNA unconventional splicing in rice (Oryza sativa L.) involved in ER stress responses. Mol Plant, 5(2), 504-514. doi: 10.1093/mp/ssr115
Oono, Youko, Wakasa, Yuhya, Hirose, Sakiko, Yang, Lijun, Sakuta, Chiyoko, & Takaiwa, Fumio. (2010). Analysis of ER stress in developing rice endosperm accumulating β-amyloid peptide. Plant Biotechnology Journal, 8(6), 691-718. doi: 10.1111/j.1467-7652.2010.00502.x
Takahashi, H., Kawakatsu, T., Wakasa, Y., Hayashi, S., & Takaiwa, F. (2012). A rice transmembrane bZIP transcription factor, OsbZIP39, regulates the endoplasmic reticulum stress response. Plant Cell Physiol, 53(1), 144-153. doi: 10.1093/pcp/pcr157
Wakasa, Y., Yasuda, H., Oono, Y., Kawakatsu, T., Hirose, S., Takahashi, H., . . . Takaiwa, F. (2011). Expression of ER quality control-related genes in response to changes in BiP1 levels in developing rice endosperm. Plant J, 65(5), 675-689. doi: 10.1111/j.1365-313X.2010.04453.x
Yang, Y. G., Lv, W. T., Li, M. J., Wang, B., Sun, D. M., & Deng, X. (2013). Maize Membrane-Bound Transcription Factor Zmbzip17 is a Key Regulator in the Cross-Talk of ER Quality Control and ABA Signaling. Plant and Cell Physiology, 54(12), 2020-2033. doi: 10.1093/pcp/pct142
Structured Information
| Gene Name |
Os06g0622700 |
|---|---|
| Description |
Eukaryotic transcription factor, DNA-binding domain containing protein |
| Version |
NM_001064635.1 GI:115469001 GeneID:4341554 |
| Length |
1991 bp |
| Definition |
Oryza sativa Japonica Group Os06g0622700, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:25918948..25920938 |
| Sequence Coding Region |
25918979..25919418,25919822..25920042,25920504..25920757 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008399:25918948..25920938 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008399:25918948..25920938 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggatgtagagttcttcgccgacctcgacctcgacgcgctcctcgcctccttctcctcctccgccgccgccgccggctccggcgtctcgggcctcttcgccccgtcaccgccgcacgatgcggaggcggggtcgccggagtcggtgagctcccggcggcccagcccttcccgggaggcggcgctgtcggagatcgagaggttcctgatggaggagggccccgcggcggaggagggggtcggcgcggaggatttcttcgacgcgctgctcgtcgacggcggggaggaggaggaggaagaagaggggaaggggagtgaggcggggggaagcacggatggggattccgggaaggagaatgaggtggctaccccggacgcggagaaggaggatgtggaggcggaggtggatggcgatgatcccatgagcaagaagaagaggaggcagatgagaaatagggattctgccatgaaatcgagggagaggaagaagatgtatgttaaggacctagagactaagagcaagtatctagaggccgagtgtcgtcgcctcagctacgcgcttcagtgctgcgcagctgagaacatggcgctgcgccagagcttgttgaaggataggcctgtcggtgccgccacagccatgcaggagtctgccgtactcacggaaaccctgccgctggtttccctgctttggctcgtgagcatcgtgtgcctactcccggtgcccggtctacccaaccgaaacccggtggctcgaagcagcgccggaagagatctcgcgacggtaaccggaaagaagacaagcagtgaacaacagctagaagaaacattactactccatgggaggcgttgcaagggctcgagggcgaggatcaagctagataccggaccgttccgtttagcagcagctgcttgctag</cdnaseq> |
| Protein Sequence |
<aaseq>MDVEFFADLDLDALLASFSSSAAAAGSGVSGLFAPSPPHDAEAG SPESVSSRRPSPSREAALSEIERFLMEEGPAAEEGVGAEDFFDALLVDGGEEEEEEEG KGSEAGGSTDGDSGKENEVATPDAEKEDVEAEVDGDDPMSKKKRRQMRNRDSAMKSRE RKKMYVKDLETKSKYLEAECRRLSYALQCCAAENMALRQSLLKDRPVGAATAMQESAV LTETLPLVSLLWLVSIVCLLPVPGLPNRNPVARSSAGRDLATVTGKKTSSEQQLEETL LLHGRRCKGSRARIKLDTGPFRLAAAAC</aaseq> |
| Gene Sequence |
<dnaseqindica>32..471#875..1095#1557..1810#gagagacaaaaatatctccatcgcgatctccatggatgtagagttcttcgccgacctcgacctcgacgcgctcctcgcctccttctcctcctccgccgccgccgccggctccggcgtctcgggcctcttcgccccgtcaccgccgcacgatgcggaggcggggtcgccggagtcggtgagctcccggcggcccagcccttcccgggaggcggcgctgtcggagatcgagaggttcctgatggaggagggccccgcggcggaggagggggtcggcgcggaggatttcttcgacgcgctgctcgtcgacggcggggaggaggaggaggaagaagaggggaaggggagtgaggcggggggaagcacggatggggattccgggaaggagaatgaggtggctaccccggacgcggagaaggaggatgtggaggcggaggtggatggcgatgatcccatgagcaagaagaagaggaggtatgtatgaattgcctaaaaacttgggatttctaaaaatcagggggatttcgtgtgtacaaagatttgtgaatttacataggtagctaggaataatggtcaggttttagttcaacacaattgatcttattcagtgagtgccagaagtccagaaccgcactacacccatagtacattttttttattaattaaaacattatatatgtacatacatgagtatatgatctaatttgtcgtaataagatgcatggtctttttagtgctaatcctttgtgaaattgtaagaaattgctaggctttcaattataagagtgtatggtcttttcaactataagatgttttccgtaatcaaagatgttctagttagacaataatctaatagtatgtgttatgaatttatcaggcagatgagaaatagggattctgccatgaaatcgagggagaggaagaagatgtatgttaaggacctagagactaagagcaagtatctagaggccgagtgtcgtcgcctcagctacgcgcttcagtgctgcgcagctgagaacatggcgctgcgccagagcttgttgaaggataggcctgtcggtgccgccacagccatgcaggagtctgccgtactcacgggtaagacatatcgacaacattttctgtttcatacttctatttcgacatggatgaacaaatcttttcttgccgatcattttgaattgctcagtatgctgacaaacttgtgcttggcatcaatatattcggtgtggtctcatggatgatccgcctaagctaatttttgttgaattcccatgaaatcaaacagctagctattgtagttatagccaattgttgactacattttctgtgtacaagtatgcgtggtttatgcacaaatctgcattgtttatacaataacacttgcttagccttttgttttccaactttggacctaatcagtcaccgaccgaagttgacattaactggaacatggtttctttgctatcctacagtatgcttgagtcataatcctgatgctcctacagtatatttgtgtcataaacctgatgctaaaggtaaccttttcctgtttgcagaaaccctgccgctggtttccctgctttggctcgtgagcatcgtgtgcctactcccggtgcccggtctacccaaccgaaacccggtggctcgaagcagcgccggaagagatctcgcgacggtaaccggaaagaagacaagcagtgaacaacagctagaagaaacattactactccatgggaggcgttgcaagggctcgagggcgaggatcaagctagataccggaccgttccgtttagcagcagctgcttgctaggctgccgcttccttgcaaagttgtttccagtctgtattgtagctagcaaatcaaattggcgtgtctatcgcctgtcgtgctgccgcttatccatggactatctttttctttttttggttccttccccccttgtttttataatatcctcctatgcataatgcattatccaggtagttttgaa</dnaseqindica> |
| External Link(s) |