Difference between revisions of "Os10g0573400"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Annotated Information)
Line 21: Line 21:
  
 
[[File:wz2.jpg]]
 
[[File:wz2.jpg]]
 +
 
OC7 includes PYR1, PYL1, PYL2, PYL3, PYL4,PYL5, PYL6, PYL7, PYL8, PYL9, PYL10, PYL11, PYL12, and PYL13 (underlined). Genes of ''A. thaliana'', ''A. lyrata'', ''P. trichocarpa'', ''O. sativa'', ''S. moellendorffii'', and ''P. patens'' begin with"AT","Araly1","POPTR","Os","Selmol"and "Phypa1_1", respectively.
 
OC7 includes PYR1, PYL1, PYL2, PYL3, PYL4,PYL5, PYL6, PYL7, PYL8, PYL9, PYL10, PYL11, PYL12, and PYL13 (underlined). Genes of ''A. thaliana'', ''A. lyrata'', ''P. trichocarpa'', ''O. sativa'', ''S. moellendorffii'', and ''P. patens'' begin with"AT","Araly1","POPTR","Os","Selmol"and "Phypa1_1", respectively.
  

Revision as of 07:04, 20 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Abscisic acid (ABA) is an essential phytohormone that regulates plant stress responses. The gene Os10g0573400 possesses most of the key protein functions of ABA-related genes. Studies on rice ABA receptors are compulsory to know the properties of ABA and this gene has significance in expressing one of ABA receptors named OsPYL1 in rice. In two species (A. thaliana and O. sativa), duplicate genes include Os10g0573400 related to ABA signaling pathways contribute to the expression variation in different organs or stress responses.


Expression

Please input expression information here.

Evolution

Please input evolution information here.

It is the common ancestor of many species such as A. thaliana, Arabidopsis lyrata, Populustrichocarpa, Oryza sativa, Selaginella moellendorffii, and Physcomitrella patens.Twelve ABA receptor orthologs named OsPYL1–12 in Oryza sativa (OsPYLs) are identified. OsPYL1 corresponds to Os10g0573400 which is showed in the following chaters.

Wz1.jpg

Phylogenetic relationships in orthologous cluster 7 including ABA receptor genes. An orthologous cluster (OC) is defined to have genes diverged in each species from a gene in the common ancestor of these six species.

Wz2.jpg

OC7 includes PYR1, PYL1, PYL2, PYL3, PYL4,PYL5, PYL6, PYL7, PYL8, PYL9, PYL10, PYL11, PYL12, and PYL13 (underlined). Genes of A. thaliana, A. lyrata, P. trichocarpa, O. sativa, S. moellendorffii, and P. patens begin with"AT","Araly1","POPTR","Os","Selmol"and "Phypa1_1", respectively.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Hanada K, Hase T, Toyoda T, et al. Origin and evolution of genes related to ABA metabolism and its signaling pathways[J]. Journal of plant research, 2011, 124(4): 455-465.

He Y, Hao Q, Li W, et al. Identification and Characterization of ABA Receptors in Oryza sativa[J]. PloS one, 2014, 9(4): e95246.

Structured Information

Gene Name

Os10g0573400

Description

Conserved hypothetical protein

Version

NM_001072002.1 GI:115483599 GeneID:4349472

Length

1089 bp

Definition

Oryza sativa Japonica Group Os10g0573400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

{{{Chromosome}}}

Location

Chromosome 10:23221607..23222695

Sequence Coding Region

23221741..23222379

Expression

GEO Profiles:Os10g0573400

Genome Context

<gbrowseImage1> name=NC_008403:23221607..23222695 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:23221607..23222695 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagcagcaggaggaagtgccaccgccgccggcggggctggggctgacggcggaggagtacgcgcaggtgcgggcgacggtggaggcgcaccaccgctacgccgtggggccgggccaatgctcctccctcctcgcgcagcgcatccacgcgccgcccgccgccgtctgggccgtcgtccgccgcttcgactgcccccaggtgtacaagcacttcatccgcagctgcgtcctccggcccgacccccaccacgacgacaacggcaacgacctccgccccggccgcctccgcgaggtcagcgtcatctccggcctccccgccagcaccagcaccgagcgcctcgacctcctcgacgacgcccaccgcgtcttcggcttcaccatcaccggcggcgagcaccgcctccgcaactaccgatccgtcaccaccgtctcccagctcgacgagatctgcaccctcgtcctcgagtcctacatcgtcgacgtccccgacggcaacaccgaggacgacacccgcctcttcgccgacaccgtcatcaggctcaacctccagaagctcaagtccgtctccgaggccaacgccaacgccgctgccgccgccgccgctcctcctcctcctccaccggcggcggcggaatag</cdnaseq>

Protein Sequence

<aaseq>MEQQEEVPPPPAGLGLTAEEYAQVRATVEAHHRYAVGPGQCSSL LAQRIHAPPAAVWAVVRRFDCPQVYKHFIRSCVLRPDPHHDDNGNDLRPGRLREVSVI SGLPASTSTERLDLLDDAHRVFGFTITGGEHRLRNYRSVTTVSQLDEICTLVLESYIV DVPDGNTEDDTRLFADTVIRLNLQKLKSVSEANANAAAAAAAPPPPPPAAAE</aaseq>

Gene Sequence

<dnaseqindica>135..773#aaatcccaattccccatctggctcgctcgacatcttcttcactcctcacttcccccactttctctactcctagcatagcagcctcactttccctcctcgatcgaagcagcaggcggaggcggaggggatcggcgatggagcagcaggaggaagtgccaccgccgccggcggggctggggctgacggcggaggagtacgcgcaggtgcgggcgacggtggaggcgcaccaccgctacgccgtggggccgggccaatgctcctccctcctcgcgcagcgcatccacgcgccgcccgccgccgtctgggccgtcgtccgccgcttcgactgcccccaggtgtacaagcacttcatccgcagctgcgtcctccggcccgacccccaccacgacgacaacggcaacgacctccgccccggccgcctccgcgaggtcagcgtcatctccggcctccccgccagcaccagcaccgagcgcctcgacctcctcgacgacgcccaccgcgtcttcggcttcaccatcaccggcggcgagcaccgcctccgcaactaccgatccgtcaccaccgtctcccagctcgacgagatctgcaccctcgtcctcgagtcctacatcgtcgacgtccccgacggcaacaccgaggacgacacccgcctcttcgccgacaccgtcatcaggctcaacctccagaagctcaagtccgtctccgaggccaacgccaacgccgctgccgccgccgccgctcctcctcctcctccaccggcggcggcggaatagcctttttcttttctttttggacctctctgcaatttcacttctattcagggaggtgcttcgaatttgctccatgtctcatgaagttggaggaggaagggtcagcttctaatacatctcattcctggtggtgctgcctgtaataatctcttcatcttcttttttcctctcctcctcctcttctcttcctggatttcttttgcttggaatttttacttacctttgtgtgtgtgtctcacttcctgattggaatccatatttgcttttcggtggttttgttcttcattcaaattcaaattaatctatctagcatttgttc</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0573400, RefSeq:Os10g0573400