Difference between revisions of "Os03g0707600"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(Labs working on this gene)
Line 13: Line 13:
  
 
==Labs working on this gene==
 
==Labs working on this gene==
BioScience Center and Graduate School of Bioagricultural Sciences, Nagoya University, Chikusa-ku, Nagoya 464-8601, Japan
+
*BioScience Center and Graduate School of Bioagricultural Sciences, Nagoya University, Chikusa-ku, Nagoya 464-8601, Japan
Division of Biological Sciences, Graduate School of Science, Hokkaido University, Kita-ku N10-W8, Sapporo, 060-0810 Japan
+
*Division of Biological Sciences, Graduate School of Science, Hokkaido University, Kita-ku N10-W8, Sapporo, 060-0810 Japan
Nara Institute of Science and Technology, Nara 630-0101, Japan
+
*Nara Institute of Science and Technology, Nara 630-0101, Japan
Graduate School of Nutritional and Environmental Sciences, University of Shizuoka, Shizuoka 422-8526, Japan
+
*Graduate School of Nutritional and Environmental Sciences, University of Shizuoka, Shizuoka 422-8526, Japan
Faculty of Agriculture, Kyushu University, Hakozaki 6-10-1, Higashi-ku, Fukuoka 812-8581, Japan
+
*Faculty of Agriculture, Kyushu University, Hakozaki 6-10-1, Higashi-ku, Fukuoka 812-8581, Japan
  
 
==References==
 
==References==

Revision as of 10:08, 20 May 2014

Please input one-sentence summary here.

Annotated Information

Function

OsGAI, also known as slender rice 1(SLR1), is first identified as a homolog of the GAI gene of Arabidopsis. It encodes a rice DELLA protein of 625 amino acids, which is characterized as a member of the GRAS family. Sequences analyses reveal that SLR1 contains a valine (polyS/T/V), a DELLA box, a TVHYNP region, a nuclear localization signal (NLS), a leucine heptad repeat (LZ) and the VHIID motif in N-terminal and the PFYRE motif and the SAW motif in C-terminal. In addition, function domain analyses reveal that the SLR1 protein can be divided into four parts: a regulatory domain for its repression activity, a dimer formation domain essential for signal perception and repression activity, and a repression domain at the C terminus, a GA signal perception domain located at the N terminus. Gibberellin (GA), a key phytohormone, controls many crucial aspects during the whole life cycle of plants, including germination, stem elongation, flower development and stress response. The study of mutant indicates that SLR1 is a negative regulator in GA signaling pathway, and overexpressing SLR1 gene in transgenic rice plants cause dwarf phenotype. DELLA protein SLR1 represses the GA-response gene expression by direct binding to transcription factor of target gene. Application of exogenous GA causes disappearance of SLR1-GFP in nuclei,

Expression

Genomic DNA blot analysis indicates the OsGAI is a single-copy gene in the rice genome. OsGAI transcripts increased within 6h upon GA3. The subcellular localization of OsGAI in vivo shows that OsGAI-GFP fusion protein locates in the nucleus concerned with a nuclear localization signal (NLS).

Evolution

The SLR1 protein shares a high overall identity with RHT-D1a in wheat (77.2%), D8 in maize (80.3%), and RGA and GAI in Arabidopsis (41.2 and 47.2%, respectively) You can also add sub-section(s) at will.

Labs working on this gene

  • BioScience Center and Graduate School of Bioagricultural Sciences, Nagoya University, Chikusa-ku, Nagoya 464-8601, Japan
  • Division of Biological Sciences, Graduate School of Science, Hokkaido University, Kita-ku N10-W8, Sapporo, 060-0810 Japan
  • Nara Institute of Science and Technology, Nara 630-0101, Japan
  • Graduate School of Nutritional and Environmental Sciences, University of Shizuoka, Shizuoka 422-8526, Japan
  • Faculty of Agriculture, Kyushu University, Hakozaki 6-10-1, Higashi-ku, Fukuoka 812-8581, Japan

References

1. Ko Hirano;Eriko Kouketu;Hiroe Katoh;Koichiro Aya;Miyako Ueguchi-Tanaka;Makoto Matsuoka

 The suppressive function of the rice DELLA protein SLR1 is dependent on its transcriptional activation activity
 The Plant Journal, 2012, 71(3): 443-453

2. Mika Hayashi-Tsugane;Masahiko Maekawa;Qian Qian;Hirokazu Kobayashi;Shigeru Iida;Kazuo Tsugane

 A rice mutant displaying a heterochronically elongated internode carries a 100 kb deletion
 Journal of genetics and genomics, 2011, 38(3): 123-128

3. Ko Hirano;Kenji Asano;Hiroyuki Tsuji;Mayuko Kawamura;Hitoshi Mori;Hidemi Kitano;Miyako Ueguchi-Tanaka;Makoto Matsuoka

 Characterization of the Molecular Mechanism Underlying Gibberellin Perception Complex Formation in Rice
 The Plant Cell, 2010, 22(8): 2680-2696

4. Akira Ikeda;Yutaka Sonoda;Paolo Vernieri;Pierdomenico Perata;Hirohiko Hirochika and Junji Yamaguchi

 The slender Rice Mutant, with Constitutively Activated Gibberellin Signal Transduction, Has Enhanced Capacity for Abscisic Acid Level
 Plant and Cell Physiology, 2002, 43(9): 974-979

5. Hironori Itoh; Miyako Ueguchi-Tanaka; Yutaka Sato1; Motoyuki Ashikari and Makoto Matsuoka

 The Gibberellin Signaling Pathway Is Regulated by the Appearance and Disappearance of SLENDER RICE1 in Nuclei
 The Plant Cell, 2002, 14(1): 57-70

6. Akira Ikeda;Miyako Ueguchi-Tanaka;Yutaka Sonoda;Hidemi Kitano;Masaji Koshioka;Yuzo Futsuhara;Makoto Matsuoka;and Junji Yamaguchi

 slender Rice, a Constitutive Gibberellin Response Mutant, Is Caused by a Null Mutation of the SLR1 Gene, an Ortholog of the Height-Regulating Gene GAI/RGA/RHT/D8
 The Plant Cell, 2001, 13(5): 999-1010

Structured Information

Gene Name

Os03g0707600

Description

OsGAI

Version

NM_001057567.1 GI:115454862 GeneID:4333860

Length

2496 bp

Definition

Oryza sativa Japonica Group Os03g0707600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:29273085..29275580

Sequence Coding Region

29273300..29275177

Expression

GEO Profiles:Os03g0707600

Genome Context

<gbrowseImage1> name=NC_008396:29273085..29275580 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:29273085..29275580 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgaagcgcgagtaccaagaagccggcgggagcagcggcggcgggagcagcgccgatatggggtcgtgcaaggacaaggtgatggcgggggcggcgggggaggaggaggacgtcgacgagctgctggcggcgctcgggtacaaggtgcggtcgtccgacatggccgacgtcgcgcagaagctggagcagctggagatggccatggggatgggcggcgtgagcgcccccggcgccgcggatgacgggttcgtgtcgcacctggccacggacaccgtgcactacaacccctcggacctctcctcctgggtcgagagcatgctttccgagctcaacgcgccgctgccccctatcccgccagcgccgccggctgcccgccatgcttccacctcgtccactgtcaccggcggcggtggtagcggcttctttgaactcccagccgctgccgactcgtcgagtagcacctacgccctcaggccgatctccttaccggtggtggcgacggctgacccgtcggctgctgactcggcgagggacaccaagcggatgcgcactggcggcggcagcacgtcgtcgtcctcatcgtcgtcttcctctctgggcggtggggcctcgcggggctctgtggtggaggctgctccgccggcgacgcaaggggccgcggcggcgaatgcgcccgccgtgccggttgtggtggttgacacgcaggaggctgggatccggctggtgcacgcgttgctggcgtgcgcggaggccgtgcagcaggagaacttcgcggccgcggaggcgctggtcaagcagatccccacgctggccgcgtcccagggcggcgccatgcgcaaggtcgctgcctacttcggcgaggccctcgcccgccgcgtgtaccgcttccgccccgcggacagcaccctcctcgacgccgccttcgccgaccttctgcacgcccacttctacgagtcctgcccctacctcaagttcgcccacttcaccgcaaatcaagccatcctcgaggctttcgccggctgccaccgcgtccacgtcgtcgacttcggcatcaagcaggggatgcaatggccagctctcctccaggccctcgcccttcgtcccggcggccccccatcgttccgcctcaccggcgtcggccccccgcagccggacgagaccgacgccttgcagcaggtgggttggaagcttgcccagttcgcgcacaccattcgcgtcgacttccagtaccggggactcgtcgccgccactctcgcggacttggagccgttcatgctgcagccggagggcgaggcggacgcgaacgaggagcctgaggtgatcgccgtcaactcggtgttcgagctgcaccggctgctcgcgcagcccggcgcgctggagaaggtcctgggcacggtgcacgcggtgcggccaaggatcgtcaccgtggtagagcaggaggccaaccacaactccggctcattcctcgaccggttcaccgagtcgctgcactactactccaccatgttcgattccctcgagggcggcagctccggccaggccgagctctctccgccggctgccgggggcggcggtggcacggaccaggtcatgtccgaggtgtacctcggccggcagatctgcaacgtcgtggcgtgcgagggcgcggagcgcacggagcgccacgagacgctggggcagtggcgcaaccgcctcggccgcgccggcttcgagcccgtgcacctgggctccaatgcctacaaacaggcgagcacgctcctcgcgcttttcgccggcggcgacggctaccgggtggaggagaaggagggctgcctcacgctgggctggcacacgcgcccgctcatcgccacctcggcatggcgcgtcgccgcggcgtga</cdnaseq>

Protein Sequence

<aaseq>MKREYQEAGGSSGGGSSADMGSCKDKVMAGAAGEEEDVDELLAA LGYKVRSSDMADVAQKLEQLEMAMGMGGVSAPGAADDGFVSHLATDTVHYNPSDLSSW VESMLSELNAPLPPIPPAPPAARHASTSSTVTGGGGSGFFELPAAADSSSSTYALRPI SLPVVATADPSAADSARDTKRMRTGGGSTSSSSSSSSSLGGGASRGSVVEAAPPATQG AAAANAPAVPVVVVDTQEAGIRLVHALLACAEAVQQENFAAAEALVKQIPTLAASQGG AMRKVAAYFGEALARRVYRFRPADSTLLDAAFADLLHAHFYESCPYLKFAHFTANQAI LEAFAGCHRVHVVDFGIKQGMQWPALLQALALRPGGPPSFRLTGVGPPQPDETDALQQ VGWKLAQFAHTIRVDFQYRGLVAATLADLEPFMLQPEGEADANEEPEVIAVNSVFELH RLLAQPGALEKVLGTVHAVRPRIVTVVEQEANHNSGSFLDRFTESLHYYSTMFDSLEG GSSGQAELSPPAAGGGGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLG RAGFEPVHLGSNAYKQASTLLALFAGGDGYRVEEKEGCLTLGWHTRPLIATSAWRVAA A</aaseq>

Gene Sequence

<dnaseqindica>216..2093#actagttgcttgcctcttcccacctcacctcgcattgcaatctcgcatcgcctcttccttctcttcttccccttcttctccccttctcatccaacctcgcttcccaaccctggatccaaatcccaacctatcccaaagccgaaaccgaggagaggaaaaaggttacgcgcaattattactagctatagctaggtaggtttgggggaggcgagatcatgaagcgcgagtaccaagaagccggcgggagcagcggcggcgggagcagcgccgatatggggtcgtgcaaggacaaggtgatggcgggggcggcgggggaggaggaggacgtcgacgagctgctggcggcgctcgggtacaaggtgcggtcgtccgacatggccgacgtcgcgcagaagctggagcagctggagatggccatggggatgggcggcgtgagcgcccccggcgccgcggatgacgggttcgtgtcgcacctggccacggacaccgtgcactacaacccctcggacctctcctcctgggtcgagagcatgctttccgagctcaacgcgccgctgccccctatcccgccagcgccgccggctgcccgccatgcttccacctcgtccactgtcaccggcggcggtggtagcggcttctttgaactcccagccgctgccgactcgtcgagtagcacctacgccctcaggccgatctccttaccggtggtggcgacggctgacccgtcggctgctgactcggcgagggacaccaagcggatgcgcactggcggcggcagcacgtcgtcgtcctcatcgtcgtcttcctctctgggcggtggggcctcgcggggctctgtggtggaggctgctccgccggcgacgcaaggggccgcggcggcgaatgcgcccgccgtgccggttgtggtggttgacacgcaggaggctgggatccggctggtgcacgcgttgctggcgtgcgcggaggccgtgcagcaggagaacttcgcggccgcggaggcgctggtcaagcagatccccacgctggccgcgtcccagggcggcgccatgcgcaaggtcgctgcctacttcggcgaggccctcgcccgccgcgtgtaccgcttccgccccgcggacagcaccctcctcgacgccgccttcgccgaccttctgcacgcccacttctacgagtcctgcccctacctcaagttcgcccacttcaccgcaaatcaagccatcctcgaggctttcgccggctgccaccgcgtccacgtcgtcgacttcggcatcaagcaggggatgcaatggccagctctcctccaggccctcgcccttcgtcccggcggccccccatcgttccgcctcaccggcgtcggccccccgcagccggacgagaccgacgccttgcagcaggtgggttggaagcttgcccagttcgcgcacaccattcgcgtcgacttccagtaccggggactcgtcgccgccactctcgcggacttggagccgttcatgctgcagccggagggcgaggcggacgcgaacgaggagcctgaggtgatcgccgtcaactcggtgttcgagctgcaccggctgctcgcgcagcccggcgcgctggagaaggtcctgggcacggtgcacgcggtgcggccaaggatcgtcaccgtggtagagcaggaggccaaccacaactccggctcattcctcgaccggttcaccgagtcgctgcactactactccaccatgttcgattccctcgagggcggcagctccggccaggccgagctctctccgccggctgccgggggcggcggtggcacggaccaggtcatgtccgaggtgtacctcggccggcagatctgcaacgtcgtggcgtgcgagggcgcggagcgcacggagcgccacgagacgctggggcagtggcgcaaccgcctcggccgcgccggcttcgagcccgtgcacctgggctccaatgcctacaaacaggcgagcacgctcctcgcgcttttcgccggcggcgacggctaccgggtggaggagaaggagggctgcctcacgctgggctggcacacgcgcccgctcatcgccacctcggcatggcgcgtcgccgcggcgtgatcgcaaagtttttgggacgctgcaccacgtgtttgccgccgatcacggcgcgacccccccccccccccctctctctctccccggctcaccggcggcacaattgaagcttgacgtcaacgaacgctcaattgcagcgaccgatcgggcttacggttctcgccggcgtgaagagatcgacgactggactccgaccagaccgacggcttgttcgttctcctttcccaattaccccgttccttggtcctcctagcccatctattatgtttaaatgtcaattattatgtgtaatttctccaatcgctcatattaaataaggacgaaccgaactggatttcattagctccaatgagaattttgtatacaaggcaccgatctaaaaattgagctatatgttcatgagtta</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0707600, RefSeq:Os03g0707600