Difference between revisions of "Os03g0707600"

From RiceWiki
Jump to: navigation, search
(References)
(References)
Line 18: Line 18:
  
 
==References==
 
==References==
1,Ogawa M, Kusano T, Katsumi M, et al. Rice gibberellin-insensitive gene homolog,< i> OsGAI</i>, encodes a nuclear-localized protein capable of gene activation at transcriptional level[J]. Gene, 2000, 245(1): 21-29.
+
<references>
2,Ikeda A, Ueguchi-Tanaka M, Sonoda Y, et al. Slender rice mutant is caused by null mutation of the SLR gene, an ortholog of the height-regulating gene GAI/RGA/RHT/D8[C]//Advances in rice genetics, Los Baños, Laguna, Philippines, 22-27 October 2000. World Scientific Publishing Co. Pte. Ltd, 2003: 478-479.
+
<ref name="ref1">Ogawa M, Kusano T, Katsumi M, et al. Rice gibberellin-insensitive gene homolog,< i> OsGAI</i>, encodes a nuclear-localized protein capable of gene activation at transcriptional level[J]. Gene, 2000, 245(1): 21-29.
3,Itoh H, Ueguchi-Tanaka M, Sato Y, et al. The gibberellin signaling pathway is regulated by the appearance and disappearance of SLENDER RICE1 in nuclei[J]. The Plant Cell Online, 2002, 14(1): 57-70.
+
<ref name="ref2">Ikeda A, Ueguchi-Tanaka M, Sonoda Y, et al. Slender rice mutant is caused by null mutation of the SLR gene, an ortholog of the height-regulating gene GAI/RGA/RHT/D8[C]//Advances in rice genetics, Los Baños, Laguna, Philippines, 22-27 October 2000. World Scientific Publishing Co. Pte. Ltd, 2003: 478-479.
4,Ikeda A, Sonoda Y, Vernieri P, et al. The slender rice mutant, with constitutively activated gibberellin signal transduction, has enhanced capacity for abscisic acid level[J]. Plant and cell physiology, 2002, 43(9): 974-979.
+
<ref name="ref3">Itoh H, Ueguchi-Tanaka M, Sato Y, et al. The gibberellin signaling pathway is regulated by the appearance and disappearance of SLENDER RICE1 in nuclei[J]. The Plant Cell Online, 2002, 14(1): 57-70.
5,Ueguchi-Tanaka M, Hirano K, Hasegawa Y, et al. Release of the repressive activity of rice DELLA protein SLR1 by gibberellin does not require SLR1 degradation in the gid2 mutant[J]. The Plant Cell Online, 2008, 20(9): 2437-2446.
+
<ref name="ref4">Ikeda A, Sonoda Y, Vernieri P, et al. The slender rice mutant, with constitutively activated gibberellin signal transduction, has enhanced capacity for abscisic acid level[J]. Plant and cell physiology, 2002, 43(9): 974-979.
6,Asano K, Hirano K, Ueguchi-Tanaka M, et al. Isolation and characterization of dominant dwarf mutants, Slr1-d, in rice[J]. Molecular Genetics and Genomics, 2009, 281(2): 223-231.
+
<ref name="ref5">Ueguchi-Tanaka M, Hirano K, Hasegawa Y, et al. Release of the repressive activity of rice DELLA protein SLR1 by gibberellin does not require SLR1 degradation in the gid2 mutant[J]. The Plant Cell Online, 2008, 20(9): 2437-2446.
7,Hirano K, Asano K, Tsuji H, et al. Characterization of the molecular mechanism underlying gibberellin perception complex formation in rice[J]. The Plant Cell Online, 2010, 22(8): 2680-2696.
+
<ref name="ref6">Asano K, Hirano K, Ueguchi-Tanaka M, et al. Isolation and characterization of dominant dwarf mutants, Slr1-d, in rice[J]. Molecular Genetics and Genomics, 2009, 281(2): 223-231.
8,Hayashi-Tsugane M, Maekawa M, Qian Q, et al. A rice mutant displaying a heterochronically elongated internode carries a 100 kb deletion[J]. Journal of Genetics and Genomics, 2011, 38(3): 123-128.
+
<ref name="ref7">Hirano K, Asano K, Tsuji H, et al. Characterization of the molecular mechanism underlying gibberellin perception complex formation in rice[J]. The Plant Cell Online, 2010, 22(8): 2680-2696.
9,Hirano K, Kouketu E, Katoh H, et al. The suppressive function of the rice DELLA protein SLR1 is dependent on its transcriptional activation activity[J]. The Plant Journal, 2012, 71(3): 443-453.
+
<ref name="ref8">Hayashi-Tsugane M, Maekawa M, Qian Q, et al. A rice mutant displaying a heterochronically elongated internode carries a 100 kb deletion[J]. Journal of Genetics and Genomics, 2011, 38(3): 123-128.
 +
<ref name="ref9">Hirano K, Kouketu E, Katoh H, et al. The suppressive function of the rice DELLA protein SLR1 is dependent on its transcriptional activation activity[J]. The Plant Journal, 2012, 71(3): 443-453.
  
 
==Structured Information==
 
==Structured Information==

Revision as of 16:54, 20 May 2014

Please input one-sentence summary here.

Annotated Information

Function

OsGAI, also known as slender rice 1(SLR1), is first identified as a homolog of the GAI gene of Arabidopsis (Ogawa, et al. 2000). It encodes a rice DELLA protein of 625 amino acids, which is characterized as a member of the GRAS family. Sequences analyses reveal that SLR1 contains a valine (polyS/T/V), a DELLA box, a TVHYNP region, a nuclear localization signal (NLS), a leucine heptad repeat (LZ) and the VHIID motif in N-terminal and the PFYRE motif and the SAW motif in C-terminal (Itoh 2002). In addition, function domain analyses reveal that the SLR1 protein can be divided into four parts: a regulatory domain for its repression activity, a dimer formation domain essential for signal perception and repression activity, and a repression domain at the C terminus, a GA signal perception domain located at the N terminus. Gibberellin (GA), a key phytohormone, controls many crucial aspects during the whole life cycle of plants, including germination, stem elongation, flower development and stress response. The study of mutant indicates that SLR1 is a negative regulator in GA signaling pathway, and overexpressing SLR1 gene in transgenic rice plants cause dwarf phenotype (Itoh 2002). DELLA protein SLR1 represses the GA-response gene expression by direct binding to transcription factor of target gene. Application of exogenous GA causes disappearance of SLR1-GFP in nuclei.

Expression

Genomic DNA blot analysis indicates the OsGAI is a single-copy gene in the rice genome. OsGAI transcripts increased within 6h upon GA3. The subcellular localization of OsGAI in vivo shows that OsGAI-GFP fusion protein locates in the nucleus concerned with a nuclear localization signal (NLS).

Evolution

The SLR1 protein shares a high overall identity with RHT-D1a in wheat (77.2%), D8 in maize (80.3%), and RGA and GAI in Arabidopsis (41.2 and 47.2%, respectively)

Labs working on this gene

  • BioScience Center and Graduate School of Bioagricultural Sciences, Nagoya University, Chikusa-ku, Nagoya 464-8601, Japan
  • Division of Biological Sciences, Graduate School of Science, Hokkaido University, Kita-ku N10-W8, Sapporo, 060-0810 Japan
  • Bioscience and Biotechnology Center, Nagoya University, Nagoya 464-8601, Japan
  • Nara Institute of Science and Technology, Nara 630-0101, Japan
  • Graduate School of Nutritional and Environmental Sciences, University of Shizuoka, Shizuoka 422-8526, Japan
  • Faculty of Agriculture, Kyushu University, Hakozaki 6-10-1, Higashi-ku, Fukuoka 812-8581, Japan

References

<references> <ref name="ref1">Ogawa M, Kusano T, Katsumi M, et al. Rice gibberellin-insensitive gene homolog,< i> OsGAI</i>, encodes a nuclear-localized protein capable of gene activation at transcriptional level[J]. Gene, 2000, 245(1): 21-29. <ref name="ref2">Ikeda A, Ueguchi-Tanaka M, Sonoda Y, et al. Slender rice mutant is caused by null mutation of the SLR gene, an ortholog of the height-regulating gene GAI/RGA/RHT/D8[C]//Advances in rice genetics, Los Baños, Laguna, Philippines, 22-27 October 2000. World Scientific Publishing Co. Pte. Ltd, 2003: 478-479. <ref name="ref3">Itoh H, Ueguchi-Tanaka M, Sato Y, et al. The gibberellin signaling pathway is regulated by the appearance and disappearance of SLENDER RICE1 in nuclei[J]. The Plant Cell Online, 2002, 14(1): 57-70. <ref name="ref4">Ikeda A, Sonoda Y, Vernieri P, et al. The slender rice mutant, with constitutively activated gibberellin signal transduction, has enhanced capacity for abscisic acid level[J]. Plant and cell physiology, 2002, 43(9): 974-979. <ref name="ref5">Ueguchi-Tanaka M, Hirano K, Hasegawa Y, et al. Release of the repressive activity of rice DELLA protein SLR1 by gibberellin does not require SLR1 degradation in the gid2 mutant[J]. The Plant Cell Online, 2008, 20(9): 2437-2446. <ref name="ref6">Asano K, Hirano K, Ueguchi-Tanaka M, et al. Isolation and characterization of dominant dwarf mutants, Slr1-d, in rice[J]. Molecular Genetics and Genomics, 2009, 281(2): 223-231. <ref name="ref7">Hirano K, Asano K, Tsuji H, et al. Characterization of the molecular mechanism underlying gibberellin perception complex formation in rice[J]. The Plant Cell Online, 2010, 22(8): 2680-2696. <ref name="ref8">Hayashi-Tsugane M, Maekawa M, Qian Q, et al. A rice mutant displaying a heterochronically elongated internode carries a 100 kb deletion[J]. Journal of Genetics and Genomics, 2011, 38(3): 123-128. <ref name="ref9">Hirano K, Kouketu E, Katoh H, et al. The suppressive function of the rice DELLA protein SLR1 is dependent on its transcriptional activation activity[J]. The Plant Journal, 2012, 71(3): 443-453.

Structured Information

Gene Name

Os03g0707600

Description

OsGAI

Version

NM_001057567.1 GI:115454862 GeneID:4333860

Length

2496 bp

Definition

Oryza sativa Japonica Group Os03g0707600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:29273085..29275580

Sequence Coding Region

29273300..29275177

Expression

GEO Profiles:Os03g0707600

Genome Context

<gbrowseImage1> name=NC_008396:29273085..29275580 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:29273085..29275580 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgaagcgcgagtaccaagaagccggcgggagcagcggcggcgggagcagcgccgatatggggtcgtgcaaggacaaggtgatggcgggggcggcgggggaggaggaggacgtcgacgagctgctggcggcgctcgggtacaaggtgcggtcgtccgacatggccgacgtcgcgcagaagctggagcagctggagatggccatggggatgggcggcgtgagcgcccccggcgccgcggatgacgggttcgtgtcgcacctggccacggacaccgtgcactacaacccctcggacctctcctcctgggtcgagagcatgctttccgagctcaacgcgccgctgccccctatcccgccagcgccgccggctgcccgccatgcttccacctcgtccactgtcaccggcggcggtggtagcggcttctttgaactcccagccgctgccgactcgtcgagtagcacctacgccctcaggccgatctccttaccggtggtggcgacggctgacccgtcggctgctgactcggcgagggacaccaagcggatgcgcactggcggcggcagcacgtcgtcgtcctcatcgtcgtcttcctctctgggcggtggggcctcgcggggctctgtggtggaggctgctccgccggcgacgcaaggggccgcggcggcgaatgcgcccgccgtgccggttgtggtggttgacacgcaggaggctgggatccggctggtgcacgcgttgctggcgtgcgcggaggccgtgcagcaggagaacttcgcggccgcggaggcgctggtcaagcagatccccacgctggccgcgtcccagggcggcgccatgcgcaaggtcgctgcctacttcggcgaggccctcgcccgccgcgtgtaccgcttccgccccgcggacagcaccctcctcgacgccgccttcgccgaccttctgcacgcccacttctacgagtcctgcccctacctcaagttcgcccacttcaccgcaaatcaagccatcctcgaggctttcgccggctgccaccgcgtccacgtcgtcgacttcggcatcaagcaggggatgcaatggccagctctcctccaggccctcgcccttcgtcccggcggccccccatcgttccgcctcaccggcgtcggccccccgcagccggacgagaccgacgccttgcagcaggtgggttggaagcttgcccagttcgcgcacaccattcgcgtcgacttccagtaccggggactcgtcgccgccactctcgcggacttggagccgttcatgctgcagccggagggcgaggcggacgcgaacgaggagcctgaggtgatcgccgtcaactcggtgttcgagctgcaccggctgctcgcgcagcccggcgcgctggagaaggtcctgggcacggtgcacgcggtgcggccaaggatcgtcaccgtggtagagcaggaggccaaccacaactccggctcattcctcgaccggttcaccgagtcgctgcactactactccaccatgttcgattccctcgagggcggcagctccggccaggccgagctctctccgccggctgccgggggcggcggtggcacggaccaggtcatgtccgaggtgtacctcggccggcagatctgcaacgtcgtggcgtgcgagggcgcggagcgcacggagcgccacgagacgctggggcagtggcgcaaccgcctcggccgcgccggcttcgagcccgtgcacctgggctccaatgcctacaaacaggcgagcacgctcctcgcgcttttcgccggcggcgacggctaccgggtggaggagaaggagggctgcctcacgctgggctggcacacgcgcccgctcatcgccacctcggcatggcgcgtcgccgcggcgtga</cdnaseq>

Protein Sequence

<aaseq>MKREYQEAGGSSGGGSSADMGSCKDKVMAGAAGEEEDVDELLAA LGYKVRSSDMADVAQKLEQLEMAMGMGGVSAPGAADDGFVSHLATDTVHYNPSDLSSW VESMLSELNAPLPPIPPAPPAARHASTSSTVTGGGGSGFFELPAAADSSSSTYALRPI SLPVVATADPSAADSARDTKRMRTGGGSTSSSSSSSSSLGGGASRGSVVEAAPPATQG AAAANAPAVPVVVVDTQEAGIRLVHALLACAEAVQQENFAAAEALVKQIPTLAASQGG AMRKVAAYFGEALARRVYRFRPADSTLLDAAFADLLHAHFYESCPYLKFAHFTANQAI LEAFAGCHRVHVVDFGIKQGMQWPALLQALALRPGGPPSFRLTGVGPPQPDETDALQQ VGWKLAQFAHTIRVDFQYRGLVAATLADLEPFMLQPEGEADANEEPEVIAVNSVFELH RLLAQPGALEKVLGTVHAVRPRIVTVVEQEANHNSGSFLDRFTESLHYYSTMFDSLEG GSSGQAELSPPAAGGGGGTDQVMSEVYLGRQICNVVACEGAERTERHETLGQWRNRLG RAGFEPVHLGSNAYKQASTLLALFAGGDGYRVEEKEGCLTLGWHTRPLIATSAWRVAA A</aaseq>

Gene Sequence

<dnaseqindica>216..2093#actagttgcttgcctcttcccacctcacctcgcattgcaatctcgcatcgcctcttccttctcttcttccccttcttctccccttctcatccaacctcgcttcccaaccctggatccaaatcccaacctatcccaaagccgaaaccgaggagaggaaaaaggttacgcgcaattattactagctatagctaggtaggtttgggggaggcgagatcatgaagcgcgagtaccaagaagccggcgggagcagcggcggcgggagcagcgccgatatggggtcgtgcaaggacaaggtgatggcgggggcggcgggggaggaggaggacgtcgacgagctgctggcggcgctcgggtacaaggtgcggtcgtccgacatggccgacgtcgcgcagaagctggagcagctggagatggccatggggatgggcggcgtgagcgcccccggcgccgcggatgacgggttcgtgtcgcacctggccacggacaccgtgcactacaacccctcggacctctcctcctgggtcgagagcatgctttccgagctcaacgcgccgctgccccctatcccgccagcgccgccggctgcccgccatgcttccacctcgtccactgtcaccggcggcggtggtagcggcttctttgaactcccagccgctgccgactcgtcgagtagcacctacgccctcaggccgatctccttaccggtggtggcgacggctgacccgtcggctgctgactcggcgagggacaccaagcggatgcgcactggcggcggcagcacgtcgtcgtcctcatcgtcgtcttcctctctgggcggtggggcctcgcggggctctgtggtggaggctgctccgccggcgacgcaaggggccgcggcggcgaatgcgcccgccgtgccggttgtggtggttgacacgcaggaggctgggatccggctggtgcacgcgttgctggcgtgcgcggaggccgtgcagcaggagaacttcgcggccgcggaggcgctggtcaagcagatccccacgctggccgcgtcccagggcggcgccatgcgcaaggtcgctgcctacttcggcgaggccctcgcccgccgcgtgtaccgcttccgccccgcggacagcaccctcctcgacgccgccttcgccgaccttctgcacgcccacttctacgagtcctgcccctacctcaagttcgcccacttcaccgcaaatcaagccatcctcgaggctttcgccggctgccaccgcgtccacgtcgtcgacttcggcatcaagcaggggatgcaatggccagctctcctccaggccctcgcccttcgtcccggcggccccccatcgttccgcctcaccggcgtcggccccccgcagccggacgagaccgacgccttgcagcaggtgggttggaagcttgcccagttcgcgcacaccattcgcgtcgacttccagtaccggggactcgtcgccgccactctcgcggacttggagccgttcatgctgcagccggagggcgaggcggacgcgaacgaggagcctgaggtgatcgccgtcaactcggtgttcgagctgcaccggctgctcgcgcagcccggcgcgctggagaaggtcctgggcacggtgcacgcggtgcggccaaggatcgtcaccgtggtagagcaggaggccaaccacaactccggctcattcctcgaccggttcaccgagtcgctgcactactactccaccatgttcgattccctcgagggcggcagctccggccaggccgagctctctccgccggctgccgggggcggcggtggcacggaccaggtcatgtccgaggtgtacctcggccggcagatctgcaacgtcgtggcgtgcgagggcgcggagcgcacggagcgccacgagacgctggggcagtggcgcaaccgcctcggccgcgccggcttcgagcccgtgcacctgggctccaatgcctacaaacaggcgagcacgctcctcgcgcttttcgccggcggcgacggctaccgggtggaggagaaggagggctgcctcacgctgggctggcacacgcgcccgctcatcgccacctcggcatggcgcgtcgccgcggcgtgatcgcaaagtttttgggacgctgcaccacgtgtttgccgccgatcacggcgcgacccccccccccccccctctctctctccccggctcaccggcggcacaattgaagcttgacgtcaacgaacgctcaattgcagcgaccgatcgggcttacggttctcgccggcgtgaagagatcgacgactggactccgaccagaccgacggcttgttcgttctcctttcccaattaccccgttccttggtcctcctagcccatctattatgtttaaatgtcaattattatgtgtaatttctccaatcgctcatattaaataaggacgaaccgaactggatttcattagctccaatgagaattttgtatacaaggcaccgatctaaaaattgagctatatgttcatgagtta</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0707600, RefSeq:Os03g0707600