Difference between revisions of "Os01g0177400"

From RiceWiki
Jump to: navigation, search
(References)
(Labs working on this gene)
Line 19: Line 19:
 
==Labs working on this gene==
 
==Labs working on this gene==
 
Please input related labs here.
 
Please input related labs here.
 +
1. Makoto Matsuoka
 +
personal home page:http://www.bio.nagoya-u.ac.jp/gcoe/english/member/matsuoka.html
 +
2. Makoto Takano
 +
personal home page:http://www.pimco.com/EN/experts/pages/makototakano.aspx
  
 
==References==
 
==References==

Revision as of 17:50, 20 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. D18 CDS 1113 bp, contains three exons, encoding a 370 amino acid composition of protein products. Phytochrome in the regulation of rice section elongation of different levels, such as regulating OsGA3ox2 GA biosynthesis gene expression, the expression of ACO1 section and the elongation of the initial (Iwamoto et al. 2011) Gibberellin 3 beta hydroxylase activity (0016707) GO:

Expression

Please input expression information here. Rice genome library makes use of degenerate primers PCR amplification, filter and cloned into two gibberellin 3 beta OsGA3ox1 and OsGA3ox2 hydroxylase gene.The authors use the GC - MS full range scan and Kovats retention index to test the function of the recombinant fusion protein.Two proteins in GA20 to GA1, GA5 to GA3 and GA44 to GA38 and GA9 to GA4 show hydroxylase activity.In addition, the indirect evidence also suggests that proteins in catalytic GA9 OsGA3ox1 to 2, 3 - dehydro - GA9, GA20 to GA5 (2, 3 - dehydro - GA20) have 2, 3 dehydrogenase activity, in the process of the catalytic GA1 to GA8, GA4 to GA34 plays in the process of 2 beta hydroxylase activity.Molecules and linkage analysis showed that OsGA3ox1 located in chromosome 5 short arm distal, OsGA3ox2 located in chromosome 1 short arm distal D18 seat.OsGA3ox2 and verified by complementary experiments, the correlation of d18 by OsGA3ox2 complementary d18 - AD alleles, gm strains showed normal phenotype.The two genes are characterized by brief expression, including OsGA3ox1 expressed in unopened flower, highest OsGA3ox2 expressed in elongation of blade top (Itoh et al., 2001)

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here. 1. Makoto Matsuoka personal home page:http://www.bio.nagoya-u.ac.jp/gcoe/english/member/matsuoka.html 2. Makoto Takano personal home page:http://www.pimco.com/EN/experts/pages/makototakano.aspx

References

Please input cited references here. 1. Masao Iwamoto;Seiichiro Kiyota;Atsushi Hanada;Shinjiro Yamaguchi;Makoto Takano

 The Multiple Contributions of Phytochromes to the Control of Internode Elongation in Rice
 Plant Physiology, 2011, 157(3): 1187-1195

2. Hironori Itoh;Miyako Ueguchi-Tanaka;Naoki Sentoku;Hidemi Kitano;Makoto Matsuoka;and Masatomo Kobayashi

 Cloning and functional analysis of two gibberellin 3β-hydroxylase genes that are differently expressed during the growth of rice
 Proceedings of the National Academy of Sciences, 2001, 98(15): 8909-8914

Structured Information

Gene Name

Os01g0177400

Description

GA 3beta-hydroxylase

Version

NM_001048721.1 GI:115434855 GeneID:4323864

Length

1229 bp

Definition

Oryza sativa Japonica Group Os01g0177400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:4002659..4003887

Sequence Coding Region

4002659..4003307,4003415..4003697,4003707..4003887

Expression

GEO Profiles:Os01g0177400

Genome Context

<gbrowseImage1> name=NC_008394:4002659..4003887 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:4002659..4003887 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgccgacgccgtcgcacttgaagaacccgctctgcttcgacttccgggcggcgaggcgggtgccggagacgcacgcgtggccggggctggacgaccacccggtggtggacggcggcggcggcggcggcgaggacgcggtgccggtggtggacgtcggggcgggcgacgcggcggcgcgggcggcggagcagtggggcgcgttccttctggtcgggcacggcgtgccggcggcgctgctgtcgcgcgtcgaggagcgcgtcgcccgcgtgttctccctgccggcgtcggagaagatgcgcgccgtccgcggccccggcgagccctgcggctacggctcgccgcccatctcctccttcttctccaagctcatgtggtccgagggctacaccttctccccttcctccctccgctccgagctccgccgcctctggcccaagtccggcgacgactacctcctcttctgtgacgtgatggaggagtttcacaaggagatgcggcggctagccgacgagttgctgaggttgttcttgagggcgctggggctcaccggcgaggaggtcgccggagtcgaggcggagaggaggatcggcgagaggatgacggcgacggtgcacctcaactggtacccgaggtgcccggagccgcggcgagcgctggggctcatcgcgcacacggactcgggcttcttcaccttcgtgctccagagcctcgtcccggggctgcagctgttccgtcgagggcccgaccggtgggtggcggtgccggcggtggcgggggccttcgtcgtcaacgtcggcgacctcttccacatcctcaccaacggccgcttccacagcgtctaccaccgcgccgtcgtgaaccgcgaccgcgaccgggtctcgctcggctacttcctcggcccgccgccggacgccgaggtggcgccgctgccggaggccgtgccggccggccggagccccgcctaccgcgctgtcacgtggccggagtacatggccgtccgcaagaaggccttcgccaccggcggctccgccctcaagatggtctccaccgacgccgccgccgccgccgacgaacacgacgacgtcgccgccgccgccgacgtccacgcataa</cdnaseq>

Protein Sequence

<aaseq>MPTPSHLKNPLCFDFRAARRVPETHAWPGLDDHPVVDGGGGGGE DAVPVVDVGAGDAAARAAEQWGAFLLVGHGVPAALLSRVEERVARVFSLPASEKMRAV RGPGEPCGYGSPPISSFFSKLMWSEGYTFSPSSLRSELRRLWPKSGDDYLLFCDVMEE FHKEMRRLADELLRLFLRALGLTGEEVAGVEAERRIGERMTATVHLNWYPRCPEPRRA LGLIAHTDSGFFTFVLQSLVPGLQLFRRGPDRWVAVPAVAGAFVVNVGDLFHILTNGR FHSVYHRAVVNRDRDRVSLGYFLGPPPDAEVAPLPEAVPAGRSPAYRAVTWPEYMAVR KKAFATGGSALKMVSTDAAAAADEHDDVAAAADVHA</aaseq>

Gene Sequence

<dnaseqindica>581..1229#191..473#1..181#atgccgacgccgtcgcacttgaagaacccgctctgcttcgacttccgggcggcgaggcgggtgccggagacgcacgcgtggccggggctggacgaccacccggtggtggacggcggcggcggcggcggcgaggacgcggtgccggtggtggacgtcggggcgggcgacgcggcggcgcgggtggcgcgggcggcggagcagtggggcgcgttccttctggtcgggcacggcgtgccggcggcgctgctgtcgcgcgtcgaggagcgcgtcgcccgcgtgttctccctgccggcgtcggagaagatgcgcgccgtccgcggccccggcgagccctgcggctacggctcgccgcccatctcctccttcttctccaagctcatgtggtccgagggctacaccttctccccttcctccctccgctccgagctccgccgcctctggcccaagtccggcgacgactacctcctcttctggtatatatacatatatactctcccatgcattccatgcacatacactctacgtatatatctacctctacgtatatatctacgtattgatctacgtataatatacgcagtgacgtgatggaggagtttcacaaggagatgcggcggctagccgacgagttgctgaggttgttcttgagggcgctggggctcaccggcgaggaggtcgccggagtcgaggcggagaggaggatcggcgagaggatgacggcgacggtgcacctcaactggtacccgaggtgcccggagccgcggcgagcgctggggctcatcgcgcacacggactcgggcttcttcaccttcgtgctccagagcctcgtcccggggctgcagctgttccgtcgagggcccgaccggtgggtggcggtgccggcggtggcgggggccttcgtcgtcaacgtcggcgacctcttccacatcctcaccaacggccgcttccacagcgtctaccaccgcgccgtcgtgaaccgcgaccgcgaccgggtctcgctcggctacttcctcggcccgccgccggacgccgaggtggcgccgctgccggaggccgtgccggccggccggagccccgcctaccgcgctgtcacgtggccggagtacatggccgtccgcaagaaggccttcgccaccggcggctccgccctcaagatggtctccaccgacgccgccgccgccgccgacgaacacgacgacgtcgccgccgccgccgacgtccacgcataa</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0177400, RefSeq:Os01g0177400