Difference between revisions of "Os11g0126900"
Yingyingbei (talk | contribs) (→Expression) |
Yingyingbei (talk | contribs) (→Expression) |
||
| Line 7: | Line 7: | ||
===Expression=== | ===Expression=== | ||
| − | * ''OsNAC10'' is expressed predominantly in roots and panicles (finger 1 A).[[Image:os1.jpg|520px|thumb|right||'''Figure 1.'''''Expression analyses of OsNAC10(from reference <ref name="ref1"/>).'']] | + | * ''OsNAC10'' is expressed predominantly in roots and panicles<ref name="ref1" /> (finger 1 A).[[Image:os1.jpg|520px|thumb|right||'''Figure 1.'''''Expression analyses of OsNAC10(from reference <ref name="ref1"/>).'']] |
| − | * The expression of ''OsNAC10'' is induced by drought, high salinity, and ABA but not by low temperature(finger 1 B). | + | * The expression of ''OsNAC10'' is induced by drought, high salinity, and ABA but not by low temperature<ref name="ref1" />(finger 1 B). |
| − | * 34 root-specific and 40 leaf-specific target genes were up-regulated when ''OsNAC10'' was overexpressed in transgenic plants.Transcript levels of seven root-specific target genes [P450, Zn-finger, HAK5, 2OG-Fe(Ⅱ),NCED, NAC, and KUP3] were increased in transgenic roots. Expression of two leaf-specific target genes, LRR and Peroxidase, was found to be OsNAC10 dependent only in GOS2:OsNAC10 leaves but not in RCc3:OsNAC10 leaves. Expression of two common target genes, F-box and Muts4, was found to be OsNAC10 dependent both in roots and leaves of the GOS2:OsNAC10 plants. | + | * 34 root-specific and 40 leaf-specific target genes were up-regulated when ''OsNAC10'' was overexpressed in transgenic plants.Transcript levels of seven root-specific target genes [P450, Zn-finger, HAK5, 2OG-Fe(Ⅱ),NCED, NAC, and KUP3] were increased in transgenic roots. Expression of two leaf-specific target genes, LRR and Peroxidase, was found to be OsNAC10 dependent only in GOS2:OsNAC10 leaves but not in RCc3:OsNAC10 leaves. Expression of two common target genes, F-box and Muts4, was found to be OsNAC10 dependent both in roots and leaves of the GOS2:OsNAC10 plants<ref name="ref1" />. |
===Evolution=== | ===Evolution=== | ||
Revision as of 08:21, 21 May 2014
Please input one-sentence summary here.
The rice Os11g0126900 was reported as NAC (an acronym for NAM [No Apical Meristem], ATAF1-2, and CUC2 [Cup-Shaped Cotyledon]) domain gene, OsNAC10,in 2010 by Korean researchers.
Contents
Annotated Information
Function
OsNAC10 plays important role in enhancing stress tolerance when overexpressed in rice.
Expression
- OsNAC10 is expressed predominantly in roots and panicles[1] (finger 1 A).
Figure 1.Expression analyses of OsNAC10(from reference [1]).
- The expression of OsNAC10 is induced by drought, high salinity, and ABA but not by low temperature[1](finger 1 B).
- 34 root-specific and 40 leaf-specific target genes were up-regulated when OsNAC10 was overexpressed in transgenic plants.Transcript levels of seven root-specific target genes [P450, Zn-finger, HAK5, 2OG-Fe(Ⅱ),NCED, NAC, and KUP3] were increased in transgenic roots. Expression of two leaf-specific target genes, LRR and Peroxidase, was found to be OsNAC10 dependent only in GOS2:OsNAC10 leaves but not in RCc3:OsNAC10 leaves. Expression of two common target genes, F-box and Muts4, was found to be OsNAC10 dependent both in roots and leaves of the GOS2:OsNAC10 plants[1].
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
- School of Biotechnology and Environmental Engineering, Myongji University, Yongin 449-728, Korea.
- National Academy of Agricultural Science, Suwon 441–707, Korea.
- School of Agricultural Biotechnology, Seoul National University, Seoul 151–921, Korea.
- CropDesign NV, B–9052 Ghent, Belgium
References
1. Jeong, J. S., Kim, Y. S.,Baek, K. H.,et al. (2010). "Root-specific expression of OsNAC10 improves drought tolerance and grain yield in rice under field drought conditions." Plant Physiol 153(1): 185-197.
Structured Information
| Gene Name |
Os11g0126900 |
|---|---|
| Description |
Similar to NAC domain transcription factor |
| Version |
NM_001072159.1 GI:115483930 GeneID:4349648 |
| Length |
2046 bp |
| Definition |
Oryza sativa Japonica Group Os11g0126900, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 11:1215803..1217848 |
| Sequence Coding Region |
1216006..1216177,1216305..1216612,1216879..1216914 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008404:1215803..1217848 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008404:1215803..1217848 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgccgagcagcggcggcgccatgcctgcccttccaccaggcttccgcttccaccccaccgacgaggagctcatcgttcactacctcatgaaccaggccgcctccgtcaagtgccccgtgccaatcatcgccgaggtcaacatctacaagtgcaacccatgggaccttcctggtaaggctttgttcggcgagaacgaatggtacttcttcagcccgagggaccgcaagtaccccaacggcgctcgccccaaccgcgccgccggctcggggtactggaaggccaccggcaccgacaagtccatcctctccactccgaccagcgacaacatcggcgtcaagaaggccctcgtcttctacaagggcaagcctcccaagggcgtcaagaccgactggatcatgcacgagtaccgtctcaccggcacatcagctaacagcaccaccaccacaaagcagcgtagagcgtcatccatgaccatgaggaatccacaagaagagcaacgacttcaattcctctga</cdnaseq> |
| Protein Sequence |
<aaseq>MPSSGGAMPALPPGFRFHPTDEELIVHYLMNQAASVKCPVPIIA EVNIYKCNPWDLPGKALFGENEWYFFSPRDRKYPNGARPNRAAGSGYWKATGTDKSIL STPTSDNIGVKKALVFYKGKPPKGVKTDWIMHEYRLTGTSANSTTTTKQRRASSMTMR NPQEEQRLQFL</aaseq> |
| Gene Sequence |
<dnaseqindica>204..375#503..810#1077..1112#atttcaatccttcctcttccttagcttattagcttccttccttcactagtgccagttttcctcctacctaatctaagctagccaggtcgtcatcttcttccttcagctcacgctgaccaaacaccatctgttattctgtttgtttgtttttttaaaaaaaagaaaaaaaatctagctaggcgagccgattgaaggagctgagcatgccgagcagcggcggcgccatgcctgcccttccaccaggcttccgcttccaccccaccgacgaggagctcatcgttcactacctcatgaaccaggccgcctccgtcaagtgccccgtgccaatcatcgccgaggtcaacatctacaagtgcaacccatgggaccttcctggtaactaactaactaatcaccatacatatatatactatccatgtatcaattaaactcgatcaaattaatgccttcaaactgaccaaatttaactttgggctttgaaaatggatatgggatgttgcaggtaaggctttgttcggcgagaacgaatggtacttcttcagcccgagggaccgcaagtaccccaacggcgctcgccccaaccgcgccgccggctcggggtactggaaggccaccggcaccgacaagtccatcctctccactccgaccagcgacaacatcggcgtcaagaaggccctcgtcttctacaagggcaagcctcccaagggcgtcaagaccgactggatcatgcacgagtaccgtctcaccggcacatcagctaacagcaccaccaccacaaagcagcgtagagcgtcatccatgaccatgagggtgagattaattacttaactaatttagttttctcttcgtcgtacgtcttgtttgaaagctacttgttgtttggcataaagaaggagcaacgtgcatgttgctcttagttaactcagtacaaagtcaaatgagttgatgttgattgagcttgttttattcttggtatatattttattttttagaaaagggttaaagtttgcacgcttctaattattgtttactgcatttgtgattgtccatcagctggacgactgggtgctgtgcagaatccacaagaagagcaacgacttcaattcctctgaccaacacgaccaagaacccgaggaatcaaccgtcgaacagcttgaagacatccatgacaacaactcctctgaacaacctccagctccagctgacatgaacaaccaacagtcagatttccagcccatgacggcgatgagcatgagcaagtcatgctccctcaccgatctcctcaacaccatcgactgcgccgcgctctcgcagtttctcctcgacggctcatccgacgccatcgctgagcctcctgctcctcccagccccctaatatacacaacacctcatccaaattaccaaacactaaactataacattaacagcaacagcagcatgccacacgccttcgagtcacgcctagatcatcacgatggttacgttaacaattataatgttaatggcctgaggaggaagagaatgatggcgtgtagtgcaacttcctttgatgatggcagcagcagcaatgactttgtgcatgccgttgtcaagaaaccgcagctgctgccaagtgattcgaggggtagtggttttggaggaggttactgcaaccagcagctttcagagactgcgactggctttcagtttcagaacggcaatctgctgagccatccatttcctctgaacaatcatctgcagatgcagtagtaggcgtctagatcccgtttaccgatcgatctgaagagaggtgaattaatttcaacgaatgaaactacagattcagagaggaagatactgattgttccatttgtgatttattttgaggagttgcatgggcagatagacaaacagacggaattcttgatgtaaccgatgcaaggaaagattcagatttcttcctatggcattaatttgtgagtttttttttgttttcattttcatgtacaagaatgtaaattataaatggtaatatcgtgcaagctagtactcaagccaatttatatg</dnaseqindica> |
| External Link(s) |