Difference between revisions of "Os11g0126900"
Yingyingbei (talk | contribs) (→Function) |
Yingyingbei (talk | contribs) (→Function) |
||
| Line 5: | Line 5: | ||
===Function=== | ===Function=== | ||
''OsNAC10'' plays important role in enhancing stress tolerance when overexpressed in rice. | ''OsNAC10'' plays important role in enhancing stress tolerance when overexpressed in rice. | ||
| − | In | + | In Jeong, J. S's et al. research, they constructed two types of transgenic plants,''RCc3:OsNAC10, GOS2:OsNAC10''.A phenotype evaluation of ''RCc3:OsNAC10'', ''GOS2:OsNAC10'' and NTcontrol plants revealed no major differences at the vegetative growth stage of the entire plant.Under normal conditions, the grain yield of the ''GOS2:OsNAC10'' plants remains similar to that of the NT controls. Filling rate and 1000 grain weight of the GOS2:OsNAC10 plants were markedly reduced and the reduction appeared to be balanced by the increase in numbers of panicles and total spikelets. While under the same conditions, ''RCc3:OsNAC10'' plants’ total grain weight was increased by 5% to 14% compared with the NT controls, which was due to increased numbers of filled grains and total spikelets. Under drought conditions, ''RCc3:OsNAC10'' plants’ total grain weight increased 25% to 42% compared with NT controls. In contrast, ''GOS2:OsNAC10'' plants remain similar total grain weight with NT controls under drought condition. |
===Expression=== | ===Expression=== | ||
Revision as of 08:45, 21 May 2014
Please input one-sentence summary here.
The rice Os11g0126900 was reported as NAC (an acronym for NAM [No Apical Meristem], ATAF1-2, and CUC2 [Cup-Shaped Cotyledon]) domain gene, OsNAC10,in 2010 by Korean researchers.
Contents
Annotated Information
Function
OsNAC10 plays important role in enhancing stress tolerance when overexpressed in rice. In Jeong, J. S's et al. research, they constructed two types of transgenic plants,RCc3:OsNAC10, GOS2:OsNAC10.A phenotype evaluation of RCc3:OsNAC10, GOS2:OsNAC10 and NTcontrol plants revealed no major differences at the vegetative growth stage of the entire plant.Under normal conditions, the grain yield of the GOS2:OsNAC10 plants remains similar to that of the NT controls. Filling rate and 1000 grain weight of the GOS2:OsNAC10 plants were markedly reduced and the reduction appeared to be balanced by the increase in numbers of panicles and total spikelets. While under the same conditions, RCc3:OsNAC10 plants’ total grain weight was increased by 5% to 14% compared with the NT controls, which was due to increased numbers of filled grains and total spikelets. Under drought conditions, RCc3:OsNAC10 plants’ total grain weight increased 25% to 42% compared with NT controls. In contrast, GOS2:OsNAC10 plants remain similar total grain weight with NT controls under drought condition.
Expression
- OsNAC10 is expressed predominantly in roots and panicles[1] (finger 1 A).
Figure 1.Expression analyses of OsNAC10(from reference [1]).
- The expression of OsNAC10 is induced by drought, high salinity, and ABA but not by low temperature[1].(finger 1 B)
- 34 root-specific and 40 leaf-specific target genes were up-regulated when OsNAC10 was overexpressed in transgenic plants.Transcript levels of seven root-specific target genes [P450, Zn-finger, HAK5, 2OG-Fe(Ⅱ),NCED, NAC, and KUP3] were increased in transgenic roots. Expression of two leaf-specific target genes, LRR and Peroxidase, was found to be OsNAC10 dependent only in GOS2:OsNAC10 leaves but not in RCc3:OsNAC10 leaves. Expression of two common target genes, F-box and Muts4, was found to be OsNAC10 dependent both in roots and leaves of the GOS2:OsNAC10 plants[1].
Evolution
According to the phylogenic analysis of the amino acid sequences of 18 OsNAC proteins, OsNAC10 is in the subgroup Ⅰ[1].
You can also add sub-section(s) at will.
Labs working on this gene
- School of Biotechnology and Environmental Engineering, Myongji University, Yongin 449-728, Korea.
- National Academy of Agricultural Science, Suwon 441–707, Korea.
- School of Agricultural Biotechnology, Seoul National University, Seoul 151–921, Korea.
- CropDesign NV, B–9052 Ghent, Belgium
References
<references> [1]
Structured Information
| Gene Name |
Os11g0126900 |
|---|---|
| Description |
Similar to NAC domain transcription factor |
| Version |
NM_001072159.1 GI:115483930 GeneID:4349648 |
| Length |
2046 bp |
| Definition |
Oryza sativa Japonica Group Os11g0126900, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 11:1215803..1217848 |
| Sequence Coding Region |
1216006..1216177,1216305..1216612,1216879..1216914 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008404:1215803..1217848 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008404:1215803..1217848 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgccgagcagcggcggcgccatgcctgcccttccaccaggcttccgcttccaccccaccgacgaggagctcatcgttcactacctcatgaaccaggccgcctccgtcaagtgccccgtgccaatcatcgccgaggtcaacatctacaagtgcaacccatgggaccttcctggtaaggctttgttcggcgagaacgaatggtacttcttcagcccgagggaccgcaagtaccccaacggcgctcgccccaaccgcgccgccggctcggggtactggaaggccaccggcaccgacaagtccatcctctccactccgaccagcgacaacatcggcgtcaagaaggccctcgtcttctacaagggcaagcctcccaagggcgtcaagaccgactggatcatgcacgagtaccgtctcaccggcacatcagctaacagcaccaccaccacaaagcagcgtagagcgtcatccatgaccatgaggaatccacaagaagagcaacgacttcaattcctctga</cdnaseq> |
| Protein Sequence |
<aaseq>MPSSGGAMPALPPGFRFHPTDEELIVHYLMNQAASVKCPVPIIA EVNIYKCNPWDLPGKALFGENEWYFFSPRDRKYPNGARPNRAAGSGYWKATGTDKSIL STPTSDNIGVKKALVFYKGKPPKGVKTDWIMHEYRLTGTSANSTTTTKQRRASSMTMR NPQEEQRLQFL</aaseq> |
| Gene Sequence |
<dnaseqindica>204..375#503..810#1077..1112#atttcaatccttcctcttccttagcttattagcttccttccttcactagtgccagttttcctcctacctaatctaagctagccaggtcgtcatcttcttccttcagctcacgctgaccaaacaccatctgttattctgtttgtttgtttttttaaaaaaaagaaaaaaaatctagctaggcgagccgattgaaggagctgagcatgccgagcagcggcggcgccatgcctgcccttccaccaggcttccgcttccaccccaccgacgaggagctcatcgttcactacctcatgaaccaggccgcctccgtcaagtgccccgtgccaatcatcgccgaggtcaacatctacaagtgcaacccatgggaccttcctggtaactaactaactaatcaccatacatatatatactatccatgtatcaattaaactcgatcaaattaatgccttcaaactgaccaaatttaactttgggctttgaaaatggatatgggatgttgcaggtaaggctttgttcggcgagaacgaatggtacttcttcagcccgagggaccgcaagtaccccaacggcgctcgccccaaccgcgccgccggctcggggtactggaaggccaccggcaccgacaagtccatcctctccactccgaccagcgacaacatcggcgtcaagaaggccctcgtcttctacaagggcaagcctcccaagggcgtcaagaccgactggatcatgcacgagtaccgtctcaccggcacatcagctaacagcaccaccaccacaaagcagcgtagagcgtcatccatgaccatgagggtgagattaattacttaactaatttagttttctcttcgtcgtacgtcttgtttgaaagctacttgttgtttggcataaagaaggagcaacgtgcatgttgctcttagttaactcagtacaaagtcaaatgagttgatgttgattgagcttgttttattcttggtatatattttattttttagaaaagggttaaagtttgcacgcttctaattattgtttactgcatttgtgattgtccatcagctggacgactgggtgctgtgcagaatccacaagaagagcaacgacttcaattcctctgaccaacacgaccaagaacccgaggaatcaaccgtcgaacagcttgaagacatccatgacaacaactcctctgaacaacctccagctccagctgacatgaacaaccaacagtcagatttccagcccatgacggcgatgagcatgagcaagtcatgctccctcaccgatctcctcaacaccatcgactgcgccgcgctctcgcagtttctcctcgacggctcatccgacgccatcgctgagcctcctgctcctcccagccccctaatatacacaacacctcatccaaattaccaaacactaaactataacattaacagcaacagcagcatgccacacgccttcgagtcacgcctagatcatcacgatggttacgttaacaattataatgttaatggcctgaggaggaagagaatgatggcgtgtagtgcaacttcctttgatgatggcagcagcagcaatgactttgtgcatgccgttgtcaagaaaccgcagctgctgccaagtgattcgaggggtagtggttttggaggaggttactgcaaccagcagctttcagagactgcgactggctttcagtttcagaacggcaatctgctgagccatccatttcctctgaacaatcatctgcagatgcagtagtaggcgtctagatcccgtttaccgatcgatctgaagagaggtgaattaatttcaacgaatgaaactacagattcagagaggaagatactgattgttccatttgtgatttattttgaggagttgcatgggcagatagacaaacagacggaattcttgatgtaaccgatgcaaggaaagattcagatttcttcctatggcattaatttgtgagtttttttttgttttcattttcatgtacaagaatgtaaattataaatggtaatatcgtgcaagctagtactcaagccaatttatatg</dnaseqindica> |
| External Link(s) |
