Difference between revisions of "Os09g0502100"

From RiceWiki
Jump to: navigation, search
Line 18: Line 18:
  
 
===Expression===
 
===Expression===
[[File:P3.png|right|thumb|400px|'''Figure 3.''' ''Mapping of multiple transcripts(from reference) <ref name="ref1" />.'']]
+
'''''LGD1''''' expression patterns<ref name="ref1" />
'''''LGD1''''' expression patterns<ref name="ref1" />
+
* '''''LGD1''''' encodes multiple transcripts using different transcription start sites (TSSs) in multiple promoter regions with unique spatiotemporal expression profiles.At least six '''''LGD1''''' transcript variants were found and named '''''LGD1.1–LGD1.6''''' according to their TSS positions and sizes (Figure 3).
* '''''LGD1''''' encodes multiple transcripts using different transcription start sites (TSSs) in multiple promoter regions with unique spatiotemporal expression profiles.At least six '''''LGD1''''' transcript variants were found and named '''''LGD1.1–LGD1.6''''' according to their TSS positions and sizes (Figure 3)
+
[[File:P3.png|right|thumb|380px|'''Figure 3.''' ''Mapping of multiple transcripts(from reference) <ref name="ref1" />.'']]
* '''''LGD1.1''''' was expressed in all tissues examined except for leaf blade, whereas '''''LGD1.2'''''was highly expressed only in the panicle and spikelet branches, and '''''LGD1.3'''''showed patterns similar to '''''LGD1.2''''' but included in the node. Transcript LGD1.4, however, was expressed in all tissues except root and leaf blade (Figure 4), the two small transcripts '''''LGD1.5''''' and '''''LGD1.6''''' were the most abundant, and were found in thepanicle (P), node (N) and leaf sheath (LS), where obvious phenotypes were observed in '''''lgd1'''''
+
* '''''LGD1.1''''' was expressed in all tissues examined except for leaf blade, whereas '''''LGD1.2'''''was highly expressed only in the panicle and spikelet branches, and '''''LGD1.3'''''showed patterns similar to '''''LGD1.2''''' but included in the node. Transcript LGD1.4, however, was expressed in all tissues except root and leaf blade (Figure 4), the two small transcripts '''''LGD1.5''''' and '''''LGD1.6''''' were the most abundant, and were found in thepanicle (P), node (N) and leaf sheath (LS), where obvious phenotypes were observed in '''''lgd1'''''.
  
 
===Evolution===
 
===Evolution===

Revision as of 11:03, 21 May 2014

Please input one-sentence summary here.

The rice Os09g0502100 was reported as lagging growth and development 1 (lgd1)[1] is screened from the Taiwan Rice Insertional Mutant (TRIM) database [2] ,showing multiple defects, including reduced number of tillers, plant height and grain yield, and abnormal panicle morphology.

Annotated Information

Figure 1. Detailed phenotypic analyses of lgd1 plants(from reference) [1].
Figure 2. tiller bud and internodes of lgd1 plants(from reference) [1].

Function

The precise function of LGD1 are still unclear [1]

  • The LGD1 C terminus contains three features: (i) a vWA domain, which is a well-characterized domain present indifferent proteins with multiple functions in animal systems; (ii) a coiled-coil domain; and (iii) a bipartite NLS.
  • The RNA binding assay verified that the C-terminus of LGD1 have the RNA binding activity through the dimeric forms.
  • Further study on the role of LGD1 as an RNA binding protein, as well as its probable functions intranscription, pre-mRNA splicing and polyadenylation to RNA modification, transport, localization.

Mutation

The phenotype of lgd1 [1]

  • The homozygous mutant conferred slow growth at the seedling stage, reduced plant height,delayed flowering and maturity, produced fewer tillers during the early phases and abnormal panicle morphology(Figure 1a–c). In particular, the difference in plant height is significant during the vegetative stage, but this difference ceases towards maturity.After the ripening stage, mature panicles of wild-type plants showed ‘compact and droopy’ architecture (Figure 1d), but lgd1 panicles were ‘open and erect’, with primary branches growing across the main rachis (Figure 1e).
  • The delayed growth and the reduced number of tillers in lgd1 were the result of delayed tiller bud formation at the four-leaf stage (Figure 2a) and the presence of fewer unelongated internodes, from which tiller buds usually arise (Figure 2b).

Expression

LGD1 expression patterns[1]

  • LGD1 encodes multiple transcripts using different transcription start sites (TSSs) in multiple promoter regions with unique spatiotemporal expression profiles.At least six LGD1 transcript variants were found and named LGD1.1–LGD1.6 according to their TSS positions and sizes (Figure 3).
Figure 3. Mapping of multiple transcripts(from reference) [1].
  • LGD1.1 was expressed in all tissues examined except for leaf blade, whereas LGD1.2was highly expressed only in the panicle and spikelet branches, and LGD1.3showed patterns similar to LGD1.2 but included in the node. Transcript LGD1.4, however, was expressed in all tissues except root and leaf blade (Figure 4), the two small transcripts LGD1.5 and LGD1.6 were the most abundant, and were found in thepanicle (P), node (N) and leaf sheath (LS), where obvious phenotypes were observed in lgd1.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os09g0502100

Description

Conserved hypothetical protein

Version

NM_001070120.2 GI:297609749 GeneID:4347489

Length

6005 bp

Definition

Oryza sativa Japonica Group Os09g0502100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:20078670..20084674

Sequence Coding Region

20078994..20080199

Expression

GEO Profiles:Os09g0502100

Genome Context

<gbrowseImage1> name=NC_008402:20078670..20084674 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:20078670..20084674 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgttactgtatgactttcttctagcagacgttactagttttgattacatggtatcagtcactgaaatttgttgctcatttctggcaggtgatcgtgtaccagctatctcaagtacctgtggaaatgaacctgcagttggcacagaggatgtgtctgtcagtagcacttctgatcctgcgaagaacatttccttgcatgatgcctcagtgaacaatagcagacaggaagacggggagcctacaagtggcatcaattttgtgccatctgaagtatttcttccagcagagtttagcacaatgcctacttctcaggatatcaatgctctcaagaatgatggtaacgagaagacgccacttgaagacataagcaccaaggatatgactgcatcacttagtgaagataatgttgaagaaaagaaagagaccgaaggcactagtgtgaaggagatgaattcaatactgaaagcagacaatgttgaagaagagaagttgactgatgacacgagtgcagagaggaatgcaatgcagcacatagatgacgctgaaaagaagcaggctgctgacactgtttcgagggaaacgagtgctctacaaaacatagaagaaagggaaaacgttgaaggtactggtgctaagggagtgccagcagtagggagcttggaaaatgctgatgcggagaatcagactgaagacaccagtgcaaagacagaatgtaaatcagataatgctgacaacaagaagcagagttacgacacaagcacagaggagatgaatgccaagaatcaagctcaagatacttcctcaaaggagatgaacaccatacaaaacacatctaatgctgaagaaaagaaccaaactgaagacccagctgtccaggagggaaacaagcagaaggaaggcatctctcccacagtagcgaagcagagttcagaaagagttcatgtccctctcaaggtgctcctagccgaggcgagtgtggagacgaaagaaaagaaaaccactgccaaggagcgtgttttgtcattcaggcgccgagtatcgaaggacgactcatcgtcggccaagtccgggtccccaaaacctggtgctgatgacaacaaattctggagctccccagcaagattgcccgagaacaatgctgagaagaaatccaaagcaaggaagcagccatggatgccgttcatttgctgtcactcggtgcactaa</cdnaseq>

Protein Sequence

<aaseq>MLLYDFLLADVTSFDYMVSVTEICCSFLAGDRVPAISSTCGNEP AVGTEDVSVSSTSDPAKNISLHDASVNNSRQEDGEPTSGINFVPSEVFLPAEFSTMPT SQDINALKNDGNEKTPLEDISTKDMTASLSEDNVEEKKETEGTSVKEMNSILKADNVE EEKLTDDTSAERNAMQHIDDAEKKQAADTVSRETSALQNIEERENVEGTGAKGVPAVG SLENADAENQTEDTSAKTECKSDNADNKKQSYDTSTEEMNAKNQAQDTSSKEMNTIQN TSNAEEKNQTEDPAVQEGNKQKEGISPTVAKQSSERVHVPLKVLLAEASVETKEKKTT AKERVLSFRRRVSKDDSSSAKSGSPKPGADDNKFWSSPARLPENNAEKKSKARKQPWM PFICCHSVH</aaseq>

Gene Sequence

<dnaseqindica>4476..5681#catccatcgccgccgccgccgccgccgcattcgccgccgtcgagtcgtcgtcgtcgccggtcaccgccgccattggcgagaagcggagaaggggaggggagtgggggggcatatcaatggagggggaggaggggaggaaggggaaggaggcactgagcggggggcacctctgccacgtgtgcgggtaccagtaccccaacgcgaaccctagcgcgaagctccgccgctcccaccggaagaactgcgggaaggcgccggccgcggacgagcgggaggagggggaggaggtggacgccgacatggagcgcaatgcgggggaggggctcctgccaggtacggtttatatttggtgtgcttctccttggattgggttgtctcgggttcttgggtttttgatggtttcgcgcgttcgtgttcgctgcagttagagcaggaggaggtgagtcggaggggaatgcaggctctccatcgctcggatctgcgagaggagatgctgatttggtggaggtgaaggagattgcaggtataatctctagtattttttttcatcggtaattttctttcttgctttctcgtttaccgctcaatctatctcgtgtatcttgctggtaatttttctttgttgccttttcgtttaccgctcaatctcgtgtgctatattaaattcgaggttttcgtgtggggttcgttgcaattatccttgattttgcctgcttgcattgtgagatgtgagagctgacaaaatcgatgatagatcgcgatgattgctgctaactaaatccgcaatctttcataagctttgcttctgctgcgtgcaacgttgtgctttttgttgtcttgcttggtttgttgctagagaggctgaaaaaggcaaaaagtatggctgccttttgctcatcagtcccccccttggagagggacaggaaactcacatggcatagtgagatggtactgttctggggtactggagtaaaggtccgtgtggttcttggttagcattaaagctgaaagcattggtactttcttgttttctttggagttggagagatacttgtgtgagaatgatgtagaaatagttggagtgaattgtttttctgacttgcaaactgtagatctgaactttgctgagtcacttggtgttgagtgttaaataaagtagtaaagctaatcactgagattcaagtgttccttccaccgtctagcacctagattatctctccgtgtttcacggcaagttggtggcttggtaatgttagtcagcagtaagaagcctttgcttgtctttgtggtcatatacttcatcggattctttctcgaaactggcagtcagacaaggtgaactgatttgttggtttcttggtacatctttcatgctaaatatccgacatatctgtcattactcttgttggtaggtaagatagcttagaagctgtcttcctacacatggtcttacaccacatgctatcctagtgacatgtgcgtttggtttgctatgctgaattgtttagtctccttatgtggatgcatgtctcttgaaattttggttgtatccttattataatactgtgaagtcatctacttggacagatcattcagggtgttgacatgagtttctgtaatttattacctaattgttgtgactagtccatgtttttttaaaggtctgtggccatgctgttatgtagtatcgtccattaattctggagtcattatgctgctaagtttctaatgactgcaatcccattatactatttacagcaaactcgtctttcaattgttttatgggcccgattttcagggttagtcctctatatcaatataaagttagctagggcaaacttgtgcagcagttacttaagactgtgttattaatcaaattatgaattaggcgtgtacagtcttctgtgaatagtaaattatgaaataggtgtgtacagtctttccaccttttgcggtgattttttattgtcttctgtgaaacctctcattttgctcctattagcaaataatgacagtggaaagagtgctactgtggaaatactaaatatattaggaaataaacctacgcaataaaaatagcttttatgggtcttatttacactctttagtttctgttagtaataactccctatgtccacaagctaattttggtgcacatcaggaatttagagacattttctcccaataacctagtatagctcacgttattaacttattagaacatatccttttccacaataacttagcatgagttcttaacatttcctgttacttcgtctagtcttttgtatccttccatgcttttattggaaacacctttaatggttactgatttattatgctgacaatcctagtaaaatattaatgcttttgagttgtttttgatcattcctgccatcctttgtttcactaataagtgttcttttccacgttacttattatttcatgttttagttcatctaacaatgtgttggtttgattctttaatagaacatgcttctccaaacgttaccggagttcaagtcatcactggttactgcagtgaagctggtgtgattaattgcgcaagtcattctgatgaaatttcaaaagaaggtatgaaaactaacttatgaaggccttgcaccaatgaagtcaaaattaagttgcagaacattactctgaaatttcaccacttgcagttggacgtccggctgaacgagaagatagtcttgatgagtaccaggacgcgtctccttttcttcatcaaccagattctgaagttggtgcagcagtagcacataagtcagatttttctattgaagaaattaagaatttggatagtgtttcaccagcagcaagtgtagcagcaaatgaaatttctgtggaaatggatggagtatcgaaagatcagttatcaggacaacccaatatgactaatttatctggtgaatccatagttggaaaagaagttgagcctactgtgatgcttgagagttcagatgaattctcagttaatgttcacagtgataatacatatattgttgacagcaaacctgataagacatctgagtttattggtgatgtgaatggttcaacttcatttatttctgacctaacatcccaatctacaagtcccataatggttgaaagcttgatggaagatagcatggatgctctgcacatcatatctgaagtatcaccaagtttggaagaaaaagcaggatcagccaatgctgaatctgtaacagaaaattccagaattgactttgtgcaaactgaagatcaactgaagctcaccaatgctgtaaataccttgacagattgctcttcacagtacaagtgtgttaaagatactttagatgcccagctgcctgttgagaatccgttcctgggtaattcagtatgttctttagatggtcatcagagtgaccatgttgttactaatatggatagcatgtggggttctgatgatgaagatatttgtagtgaaggcatcaaagcgaagggcagtgagttgggtttttcttgtgaggagaacccacaacatgtcgagttggttgataaagcagatgaaaatccttctgtagagaagcctaatggattatcagaagaggtggtctgcagcaaagagattggccctgaggttcctattataggccaggtctctgcaagtcagcatgttgccttactaatggatcaagtgtccacaaagaatccgttcattctagatgataccaggagcgacgacttatttgagcttccaactgagaattaccattcggaagcacaaaatgttgctgaatcaaagctgcaagttgactttacacctctgccattggatcagctgataattgtggaccaaactagcattgctgaaggccagcaatttgtcatctcaggttaggattgttttaccgtggattatgtacaagccagtaattctatttctgctgtatgttttttaatgtcgttaattcattgctgaaatttaatgcgtccaggctatatatgctttagtctagcttttatttgacagcctgtacatgtttgtttggtttttaaagaaaattggtaaaaatgctaagctgtggagggaatttatctaaaatgtcacgtggttaaggtgttcaggcaaatgatattctgctttagtgccttacatggatataaagaagttaaatcaacagcggtagattcttaaattatatgtactacttcctgcataaatgctcactcacgagtcatgacgatggcttcacttgcttgctggaattcacagtagacttttaaatcctaatcttgttagcagtattttcttggggatggctactgtacaaacaacttttatcatagttttcctctctttgcatggcacatgttgccttgttatcacctctggagagaatagtggataatggtaaaatgattgtgaatacagagctagttgctctgtattgtcatatgttaaaatcgtttcaattctccctattccaatgttactgtatgactttcttctagcagacgttactagttttgattacatggtatcagtcactgaaatttgttgctcatttctggcaggtgatcgtgtaccagctatctcaagtacctgtggaaatgaacctgcagttggcacagaggatgtgtctgtcagtagcacttctgatcctgcgaagaacatttccttgcatgatgcctcagtgaacaatagcagacaggaagacggggagcctacaagtggcatcaattttgtgccatctgaagtatttcttccagcagagtttagcacaatgcctacttctcaggatatcaatgctctcaagaatgatggtaacgagaagacgccacttgaagacataagcaccaaggatatgactgcatcacttagtgaagataatgttgaagaaaagaaagagaccgaaggcactagtgtgaaggagatgaattcaatactgaaagcagacaatgttgaagaagagaagttgactgatgacacgagtgcagagaggaatgcaatgcagcacatagatgacgctgaaaagaagcaggctgctgacactgtttcgagggaaacgagtgctctacaaaacatagaagaaagggaaaacgttgaaggtactggtgctaagggagtgccagcagtagggagcttggaaaatgctgatgcggagaatcagactgaagacaccagtgcaaagacagaatgtaaatcagataatgctgacaacaagaagcagagttacgacacaagcacagaggagatgaatgccaagaatcaagctcaagatacttcctcaaaggagatgaacaccatacaaaacacatctaatgctgaagaaaagaaccaaactgaagacccagctgtccaggagggaaacaagcagaaggaaggcatctctcccacagtagcgaagcagagttcagaaagagttcatgtccctctcaaggtgctcctagccgaggcgagtgtggagacgaaagaaaagaaaaccactgccaaggagcgtgttttgtcattcaggcgccgagtatcgaaggacgactcatcgtcggccaagtccgggtccccaaaacctggtgctgatgacaacaaattctggagctccccagcaagattgcccgagaacaatgctgagaagaaatccaaagcaaggaagcagccatggatgccgttcatttgctgtcactcggtgcactaagcctgccatccatcttcagcagcacaaagcttctccaagctgctgctatacaccatgtgcatgttgcatcttgagttattattgatagcactagtagtagtaacagtagtaaagggcttggctatgctacgatgctctttctagtatttgcattggtctacatttgccgctgtaactaaagctccccacatcttttgtgtagatagtccatgcaagtaagattgtttggtaatgtcgagctgatacttgctgatctgcattgatgttcagactttgtgaatcatgtgcgattttgatgttcatagtaaacttgctcgtgaatgg</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0502100, RefSeq:Os09g0502100

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2