Difference between revisions of "Os03g0788500"

From RiceWiki
Jump to: navigation, search
(Isolation and sequence analysis)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
OsCPK10 is a member of OsCPKs family. Calcium-dependent protein kinases (CDPKs) are improtant calcium sensors icluded in plant responses to pathogen infection.  The expression of OsCPK10 was strongly induced following treatment with a Magnaporthe grisea elicitor. Kinase activity assay showed that the functional OsCPK10 protein not only autophosphorylated, but also phosphorylated Casein in a calcium-dependent manner. Overexpression of constitutively active OsCPK10 in Arabidopsis enhanced the resistance to infection with Pseudomonas syringae pv. tomato, associated with elevated expression of both SA- and JA-related defense genes. Similarly, transgenic rice plants containing constitutively active OsCPK10 exhibited enhanced resistance to blast fungus M. grisea. Collectively, rice OsCPK10 is a crucial regulator in plant immune responses, and that it may regulate disease resistance by activating both SA- and JA-dependent defense responses.[1]
+
OsCPK10 is a member of OsCPKs family including 29 CPKs in rice[1]. Calcium-dependent protein kinases (CDPKs) are improtant calcium sensors icluded in plant responses to pathogen infection.  The expression of OsCPK10 was strongly induced following treatment with a Magnaporthe grisea elicitor. Kinase activity assay showed that the functional OsCPK10 protein not only autophosphorylated, but also phosphorylated Casein in a calcium-dependent manner. Overexpression of constitutively active OsCPK10 in Arabidopsis enhanced the resistance to infection with Pseudomonas syringae pv. tomato, associated with elevated expression of both SA- and JA-related defense genes. Similarly, transgenic rice plants containing constitutively active OsCPK10 exhibited enhanced resistance to blast fungus M. grisea. Collectively, rice OsCPK10 is a crucial regulator in plant immune responses, and its overexpression may regulate disease resistance by activating both SA- and JA-dependent defense responses[2].
  
 
===Expression===
 
===Expression===
The expression of OsCPK10, in M.grisea elicitor-treated rice calli, shows a rapid activation and peaks at 1 hour, which is earlier than that of OsPAL1 expression. This result indicates that OsCPK10 is an early pathogen-responsive gene.[1]
+
The expression of OsCPK10, in M.grisea elicitor-treated rice calli, shows a rapid activation and peaks at 1 hour, which is earlier than that of OsPAL1 expression. This result indicates that OsCPK10 is an early pathogen-responsive gene[2].
 +
[[File:Os03g0788500expression.jpg]]
  
 
===Isolation and sequence analysis===
 
===Isolation and sequence analysis===
OsCPK10 is isolated by PT-PCR from the total RNA extraction using specific primer pairs and the coding region of OsCPK10 is 1800 bp in length which encodes 599 amino acids. (Primers:forward 5'-ATGGGGAACACGTGCGTC-3' and reverse 5'-TCAAGACATCCTCAAGGCCTC-3'). The PCR products were ligated to a pEASY-T1 vector (TransGen Biotech, China).[1]
+
OsCPK10 is isolated by PT-PCR from the total RNA extraction using specific primer pairs and the coding region of OsCPK10 is 1800 bp in length which encodes 599 amino acids. (Primers:forward 5'-ATGGGGAACACGTGCGTC-3' and reverse 5'-TCAAGACATCCTCAAGGCCTC-3'). The PCR products were ligated to a pEASY-T1 vector (TransGen Biotech, China)[2].
  
 
===Evolution===
 
===Evolution===
Line 20: Line 21:
  
 
==References==
 
==References==
[1] Fu L, Yu X, An C. Overexpression of constitutively active OsCPK10 increases Arabidopsis resistance against Pseudomonas syringae pv. tomato and rice resistance against Magnaporthe grisea. Plant Physiol Biochem. 2013 Dec;73:202-10. doi: 10.1016/j.plaphy.2013.10.004. Epub 2013 Oct 11. PubMed PMID: 24141028.
+
[1] B. Wan, Y. Lin, T. Mou, Expression of rice Ca2+-dependent protein kinases (CDPKs) genes under different environmental stresses, FEBS Lett. 581 (2007)1179e1189
 +
[2] Fu L, Yu X, An C. Overexpression of constitutively active OsCPK10 increases Arabidopsis resistance against Pseudomonas syringae pv. tomato and rice resistance against Magnaporthe grisea. Plant Physiol Biochem. 2013 Dec;73:202-10. doi: 10.1016/j.plaphy.2013.10.004. Epub 2013 Oct 11. PubMed PMID: 24141028.
  
 
==Structured Information==
 
==Structured Information==

Revision as of 11:55, 21 May 2014

Please input one-sentence summary here.

Annotated Information

Function

OsCPK10 is a member of OsCPKs family including 29 CPKs in rice[1]. Calcium-dependent protein kinases (CDPKs) are improtant calcium sensors icluded in plant responses to pathogen infection. The expression of OsCPK10 was strongly induced following treatment with a Magnaporthe grisea elicitor. Kinase activity assay showed that the functional OsCPK10 protein not only autophosphorylated, but also phosphorylated Casein in a calcium-dependent manner. Overexpression of constitutively active OsCPK10 in Arabidopsis enhanced the resistance to infection with Pseudomonas syringae pv. tomato, associated with elevated expression of both SA- and JA-related defense genes. Similarly, transgenic rice plants containing constitutively active OsCPK10 exhibited enhanced resistance to blast fungus M. grisea. Collectively, rice OsCPK10 is a crucial regulator in plant immune responses, and its overexpression may regulate disease resistance by activating both SA- and JA-dependent defense responses[2].

Expression

The expression of OsCPK10, in M.grisea elicitor-treated rice calli, shows a rapid activation and peaks at 1 hour, which is earlier than that of OsPAL1 expression. This result indicates that OsCPK10 is an early pathogen-responsive gene[2]. Os03g0788500expression.jpg

Isolation and sequence analysis

OsCPK10 is isolated by PT-PCR from the total RNA extraction using specific primer pairs and the coding region of OsCPK10 is 1800 bp in length which encodes 599 amino acids. (Primers:forward 5'-ATGGGGAACACGTGCGTC-3' and reverse 5'-TCAAGACATCCTCAAGGCCTC-3'). The PCR products were ligated to a pEASY-T1 vector (TransGen Biotech, China)[2].

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

[1] B. Wan, Y. Lin, T. Mou, Expression of rice Ca2+-dependent protein kinases (CDPKs) genes under different environmental stresses, FEBS Lett. 581 (2007)1179e1189 [2] Fu L, Yu X, An C. Overexpression of constitutively active OsCPK10 increases Arabidopsis resistance against Pseudomonas syringae pv. tomato and rice resistance against Magnaporthe grisea. Plant Physiol Biochem. 2013 Dec;73:202-10. doi: 10.1016/j.plaphy.2013.10.004. Epub 2013 Oct 11. PubMed PMID: 24141028.

Structured Information

Gene Name

Os03g0788500

Description

Similar to Calcium-dependent protein kinase 2

Version

NM_001058038.1 GI:115455804 GeneID:4334366

Length

3830 bp

Definition

Oryza sativa Japonica Group Os03g0788500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:33602511..33606340

Sequence Coding Region

33603134..33603995,33604439..33604582,33604704..33604856,33604980..33605095,33605363..33605530
,33605643..33605867,33605993..33606124

Expression

GEO Profiles:Os03g0788500

Genome Context

<gbrowseImage1> name=NC_008396:33602511..33606340 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:33602511..33606340 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggggaacacgtgcgtcggccccagcatcagcaagaacggcttcttccagtccgtctccacggtgctctggaaggcgcgccaggacggcgacgacgcgctgcccggcgccaatggcgcccctgacggcggcggccagggccggttgccggcgccgccgccgccgacttccgacgcgccgctcgccgtccaaaacaagccccccgagcacgtcaagatcgtctcgaccacggacaccgcctccgccgagcaggacgcctccaagtcgagcgccggctcggactccggcgaggccgccaggccgcggccgagggtgccgccggtgaagcgcgtctccagcgccgggctgctcgtcggctcggtgctgaagcgcaagacggagagtctcaaggacaagtacagcctggggcggaagctcgggcaggggcagttcgggacgacgtacctgtgcgtggagcgcgccaccggcaaggagttcgcctgcaagtccatcctgaagcggaagctggtcaccgacgacgacgtcgaggacgtccgccgcgagatccagataatgtaccacctcgccggccaccccaacgtgatctccatcaggggcgcctacgaggacgccgtcgccgtgcacctcgtcatggagctctgcgccggcggcgagctgttcgaccggatcgtccagaaggggcactacaccgagcggaaggcggcggagctcgccagggtcatcgtcggcgtcgtcgaggtgtgccactccatgggcgtgatgcaccgtgatctcaagcccgagaacttcctcttcgccgaccagacggaggaggccgctctcaagaccattgactttggtctctccattttctttcgcccaggtcaagtattcactgatgttgttggtagcccttactatgtcgcgccagaagttctgaaaaagaaatatggtcaagaggcagatgtctggagcgctggtgtgataatttacatcttgttgtgtggtgtgccgccattttgggcagagaacgagcagggtatatttgaagaggttttgcatggtagacttgactttcagtcagaaccatggcctagcatctctgaaggtgccaaagatctcgtaaggagaatgcttgttagggacccgaagaagagattgacagctcatgaagttttaaggcatccatgggtccaggttggtggtttggctcctgacaagcccctggattctgctgttctatctcgtatgaagcaattctcagctatgaataagctgaaaaagatggctcttagggtcattgcagagaacctatctgaagacgaaatcgccggcctgaaagaaatgttcaagatgatcgacacagacaacagtggacagatcaccttcgaagaactcaaggttggtctgaaaaaagtcggtgctaacctccaagaatccgagatctacgcactcatgcaagccgcagatgtagataacagcggcacgatagattacggtgagttcatcgctgcaactctgcatatgaacaagatcgagcgggaggatcacctgttcgcggcgttccaatacttcgacaaggacggcagcggctacatcacggccgatgagctgcagctcgcctgcgaggagttcggcttgggagacgttcagctcgaggagatgatcagagaagtcgacgaagacaacgatggtcgcatagattacaacgagttcgtggcgatgatgcagaagccgacgatggggctcccggcgaagaagtccggcgggctgcagaacagtttcagcatcggcttcagggaggccttgaggatgtcttga</cdnaseq>

Protein Sequence

<aaseq>MGNTCVGPSISKNGFFQSVSTVLWKARQDGDDALPGANGAPDGG GQGRLPAPPPPTSDAPLAVQNKPPEHVKIVSTTDTASAEQDASKSSAGSDSGEAARPR PRVPPVKRVSSAGLLVGSVLKRKTESLKDKYSLGRKLGQGQFGTTYLCVERATGKEFA CKSILKRKLVTDDDVEDVRREIQIMYHLAGHPNVISIRGAYEDAVAVHLVMELCAGGE LFDRIVQKGHYTERKAAELARVIVGVVEVCHSMGVMHRDLKPENFLFADQTEEAALKT IDFGLSIFFRPGQVFTDVVGSPYYVAPEVLKKKYGQEADVWSAGVIIYILLCGVPPFW AENEQGIFEEVLHGRLDFQSEPWPSISEGAKDLVRRMLVRDPKKRLTAHEVLRHPWVQ VGGLAPDKPLDSAVLSRMKQFSAMNKLKKMALRVIAENLSEDEIAGLKEMFKMIDTDN SGQITFEELKVGLKKVGANLQESEIYALMQAADVDNSGTIDYGEFIAATLHMNKIERE DHLFAAFQYFDKDGSGYITADELQLACEEFGLGDVQLEEMIREVDEDNDGRIDYNEFV AMMQKPTMGLPAKKSGGLQNSFSIGFREALRMS</aaseq>

Gene Sequence

<dnaseqindica>624..1485#1929..2072#2194..2346#2470..2585#2853..3020#3133..3357#3483..3614#aggtgtcacaggtttcttctcctcttatccttcctttccatcggttcttgtacttggtggtatacccctagctgctcgcctttgtgttaatttggttggattgggagtttcttgttctctctttagccttgagcgatcttggtttcttgcaattagcctttgactgcttcttcttcttccacttgccgccggcagctagaagtggtccatcgtaccaaccctttcgtcctcattgaaccattccgcctcgctcccagctccattactagaagcactagagctagcgtgaatgcgtgatccttgatgcgtagttagcagctagctcctgcccccaatctgccatctccgcattgcgattttgagtttttgagattgtaatttgcgaacgatctcggttgtgctgagagcttagcgttgacttcgatgggtgcatcgcgttcgatcgccgattctgatttggtcgcgtgatccgggggtgatcggtgattactccgagcgggaggggagatcgtctcttggcgcggttgcgcttcgccgcgcggagggagagacattcgcggcgtaatccgaaggtgtttgttggatcgaggcgtggtgtccgagaaagattcggagcggcggcaatggggaacacgtgcgtcggccccagcatcagcaagaacggcttcttccagtccgtctccacggtgctctggaaggcgcgccaggacggcgacgacgcgctgcccggcgccaatggcgcccctgacggcggcggccagggccggttgccggcgccgccgccgccgacttccgacgcgccgctcgccgtccaaaacaagccccccgagcacgtcaagatcgtctcgaccacggacaccgcctccgccgagcaggacgcctccaagtcgagcgccggctcggactccggcgaggccgccaggccgcggccgagggtgccgccggtgaagcgcgtctccagcgccgggctgctcgtcggctcggtgctgaagcgcaagacggagagtctcaaggacaagtacagcctggggcggaagctcgggcaggggcagttcgggacgacgtacctgtgcgtggagcgcgccaccggcaaggagttcgcctgcaagtccatcctgaagcggaagctggtcaccgacgacgacgtcgaggacgtccgccgcgagatccagataatgtaccacctcgccggccaccccaacgtgatctccatcaggggcgcctacgaggacgccgtcgccgtgcacctcgtcatggagctctgcgccggcggcgagctgttcgaccggatcgtccagaaggggcactacaccgagcggaaggcggcggagctcgccagggtcatcgtcggcgtcgtcgaggtgtgccactccatgggcgtgatgcaccgtgatctcaagcccgagaacttcctcttcgccgaccagacggaggaggccgctctcaagaccattgactttggtctctccattttctttcgcccaggtgagcgaatcacattttcttttccttttttcttttccagaatggcgcattgaatttagtatctataactgttataacaaacaagatttccaatccattcaagaaatcacactgcatctatggataagtagagaatgaatatggcctaatctttcatgtactgatttgatctttagtgaatctgaagttcttgagtttcagcatttgtttttgggacaactgcattattgtgcttatgatagtactaatactgctgtgagattttatgcttcagaacttaatttcctttacctacatttcaaagttttcaacaccatttgtttctgcataagttctgcaaaaagtttggctgcatatctttaccattctgcagtctgctaccatatcattcagatgaattcattctccattgggtttctactcatatgccattcttattccaggtcaagtattcactgatgttgttggtagcccttactatgtcgcgccagaagttctgaaaaagaaatatggtcaagaggcagatgtctggagcgctggtgtgataatttacatcttgttgtgtggtgtgccgccattttgggcaggtaagaattttgctgatttttcagtcaatcacaaaacaattatactaactttcgtgacaaaatgtgatgtattttgatccgaactcttgtactaattaagctctccattgttgtgaatcagagaacgagcagggtatatttgaagaggttttgcatggtagacttgactttcagtcagaaccatggcctagcatctctgaaggtgccaaagatctcgtaaggagaatgcttgttagggacccgaagaagagattgacagctcatgaagttttaagtaagttacttgattaattttcatgatatattcctaaatgtatttttctagctattttagtagtgcagggctgcaggccatgaacagtgcagtctgatttacttggcattatcatcttttcagggcatccatgggtccaggttggtggtttggctcctgacaagcccctggattctgctgttctatctcgtatgaagcaattctcagctatgaataagctgaaaaagatggctcttagggtaagtatgacttggacacaaattgttactatatttctgatttctctatgaaatattttcccaatattaggatagcaccatcttgtcgttggccttttgtcctcatgcaccaaaggaaaatctgtttggagtttagctcatgcaagatacagtacataatcattttaaaaaataagtatccaatgttgtattagttggagaatgttgttcatcttgaatggttcaatcatacttacctgcatgtcctgatacctttgttgattccaggtcattgcagagaacctatctgaagacgaaatcgccggcctgaaagaaatgttcaagatgatcgacacagacaacagtggacagatcaccttcgaagaactcaaggttggtctgaaaaaagtcggtgctaacctccaagaatccgagatctacgcactcatgcaagccgtaagttcttaagcaatctaccaattccgtcgagtacttttacggtggtctctactggtcgaaaacatcaaaattgcatttgtatctgaattctgaaatggtattattacaggcagatgtagataacagcggcacgatagattacggtgagttcatcgctgcaactctgcatatgaacaagatcgagcgggaggatcacctgttcgcggcgttccaatacttcgacaaggacggcagcggctacatcacggccgatgagctgcagctcgcctgcgaggagttcggcttgggagacgttcagctcgaggagatgatcagagaagtcgacgaagacaacgtcagtaaaaaaaaaaaagaacctacttttccattccattctgatcgaagctagctaatcacattgcctgaaatgcttgatctgacggaactttcgctgttctttttcgtgccttgtgtttgcaggatggtcgcatagattacaacgagttcgtggcgatgatgcagaagccgacgatggggctcccggcgaagaagtccggcgggctgcagaacagtttcagcatcggcttcagggaggccttgaggatgtcttgagaaacagccactagagtcagtcacacacttgtagaggcgacgacaacgagatcgatatgttgtcttccatagggctggtaatttcgaaacggggaaaaaaatggctggaggagatgtgcgtgtacgtacaggcgtagaggggggtgggtcactcttgggtcattggttcgattgttttcttctgacgttaaaaatacaagagaggtttttcgttcc</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0788500, RefSeq:Os03g0788500