Difference between revisions of "Os03g0110800"

From RiceWiki
Jump to: navigation, search
(→‎Knowledge Extension)
(→‎Annotated Information)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
−
OsDRM2(Os03g0110800) is the major DRM1/2-type methyltransferase gene in rice. OsDRM2 is responsible for de novo, CG and non-CG methylation in rice genomic sequences, and that DNA methylation regulated by OsDRM2 is essential for proper rice development in both vegetative and reproductive stages<ref name="ref1" />.
+
''OsDRM2''(Os03g0110800) is the major DRM1/2-type methyltransferase gene in rice. ''OsDRM2'' is responsible for de novo, CG and non-CG methylation in rice genomic sequences, and that DNA methylation regulated by ''OsDRM2'' is essential for proper rice development in both vegetative and reproductive stages<ref name="ref1" />.
  
−
1. Targeted disruptants of rice OsDRM2 displayed pleiotropic developmental phenotypes in both vegetative and reproductive stages, including growth defects, semi-dwarfed stature, reductions in tiller number, delayed heading or no heading, abnormal panicle and spikelet morphology, and complete sterility(Fig 1)<ref name="ref1" />.
+
1. Targeted disruptants of rice ''OsDRM2'' displayed pleiotropic developmental phenotypes in both vegetative and reproductive stages, including growth defects, semi-dwarfed stature, reductions in tiller number, delayed heading or no heading, abnormal panicle and spikelet morphology, and complete sterility(Fig 1)<ref name="ref1" />.
  
−
2. OsDRM2 is required not only for DNA methylation ofRIRE7/CRR1sequences and5S rDNA repeats, but also for transcriptional silencing of RIRE7/CRR1 retrotransposons(Fig 2)<ref name="ref1" />.
+
2. ''OsDRM2'' is required not only for DNA methylation ofRIRE7/CRR1sequences and5S rDNA repeats, but also for transcriptional silencing of RIRE7/CRR1 retrotransposons(Fig 2)<ref name="ref1" />.
  
−
3. Impaired growth and abnormal DNA methylation of osdrm2 disruptants were restored by the complementation of wild-type OsDRM2 cDNA(Fig 3)<ref name="ref1" />.
+
3. Impaired growth and abnormal DNA methylation of osdrm2 disruptants were restored by the complementation of wild-type ''OsDRM2'' cDNA(Fig 3)<ref name="ref1" />.
 
[[File:Fig.1 OsDRM2.png|right|thumb|250px|Fig.1 Phenotype analyses of rice osdrm2 disruptants.(From reference <ref name="ref1" />).'']]
 
[[File:Fig.1 OsDRM2.png|right|thumb|250px|Fig.1 Phenotype analyses of rice osdrm2 disruptants.(From reference <ref name="ref1" />).'']]
 
[[File:Fig.2 OsDRM2.png|right|thumb|250px|Fig.2 Expression of  RIRE7/CRR1 retrotransposons and DNA methylation status of repetitive sequences in osdrm2 disruptants.(From reference <ref name="ref1" />).'']]
 
[[File:Fig.2 OsDRM2.png|right|thumb|250px|Fig.2 Expression of  RIRE7/CRR1 retrotransposons and DNA methylation status of repetitive sequences in osdrm2 disruptants.(From reference <ref name="ref1" />).'']]
Line 15: Line 15:
  
 
===Expression===
 
===Expression===
−
1. RT-PCR analysis revealed that OsDRM2 is expressed constitutively. OsDRM2 encodes a protein of 584 amino acids, containing two ubiquitin-associated (UBA) domains and conserved catalytic domains(Fig 4)<ref name="ref1" />.
+
1. RT-PCR analysis revealed that ''OsDRM2'' is expressed constitutively. ''OsDRM2'' encodes a protein of 584 amino acids, containing two ubiquitin-associated (UBA) domains and conserved catalytic domains(Fig 4)<ref name="ref1" />.
  
−
2. Peng. et al. cloned and expressed one of these homologues,OsDRM2(DMT706), in both E. coli and S.cerevisiae. De novo methylation activity was present in the transformants of both organisms. The recombinant OsDRM protein can methylate any type of cytosine nucleotide, including those in the patterns CG, CHG, and CHH. Evidence of cytosine methylation was observed in the genomic DNA of S. cerevisiae that expressed the OsDRM2 gene based on MSAP assays, bisulfite sequencing and a test of cytosine methylation by endonuclease digestion. This evidence demonstrated that the OsDRM2 protein can not only methylate cytosine nucleotidesin vivo in an RdDM pathway-free cellular environment but can also methylate cytosine nucleotides in vitro(Fig 5)<ref name="ref2" />.
+
2. Peng. et al. cloned and expressed one of these homologues,''OsDRM2''(DMT706), in both E. coli and S.cerevisiae. De novo methylation activity was present in the transformants of both organisms. The recombinant OsDRM protein can methylate any type of cytosine nucleotide, including those in the patterns CG, CHG, and CHH. Evidence of cytosine methylation was observed in the genomic DNA of S. cerevisiae that expressed the OsDRM2 gene based on MSAP assays, bisulfite sequencing and a test of cytosine methylation by endonuclease digestion. This evidence demonstrated that the OsDRM2 protein can not only methylate cytosine nucleotidesin vivo in an RdDM pathway-free cellular environment but can also methylate cytosine nucleotides in vitro(Fig 5)<ref name="ref2" />.
  
−
3. Non-coding  RNAs,  especially  small  RNAs,  play  important  roles in  the expression of OsDRM2. For instance, miR820 negatively regulates the expression of OsDRM2<ref name="ref3" /><ref name="ref4" /><ref name="ref5" />. And expression levels of various TEs are increased quite sensitively in response to decreased OsDRM2 expression and DNA methylation at TE loci(Fig 6)<ref name="ref3" />.
+
3. Non-coding  RNAs,  especially  small  RNAs,  play  important  roles in  the expression of ''OsDRM2''. For instance, miR820 negatively regulates the expression of OsDRM2<ref name="ref3" /><ref name="ref4" /><ref name="ref5" />. And expression levels of various TEs are increased quite sensitively in response to decreased OsDRM2 expression and DNA methylation at TE loci(Fig 6)<ref name="ref3" />.
 
[[File:Fig.4 OsDRM2.png|right|thumb|250px|Fig.4 RT-PCR expression analysis of  OsDRM genes in rice. (From reference <ref name="ref1" />).'']]
 
[[File:Fig.4 OsDRM2.png|right|thumb|250px|Fig.4 RT-PCR expression analysis of  OsDRM genes in rice. (From reference <ref name="ref1" />).'']]
 
[[File:Fig.5 OsDRM2.JPG|right|thumb|250px|Fig.5 MSAP analysis of genomic DNA from pBOsDRM2-transformed S. cerevisiae.(From reference <ref name="ref2" />).'']]
 
[[File:Fig.5 OsDRM2.JPG|right|thumb|250px|Fig.5 MSAP analysis of genomic DNA from pBOsDRM2-transformed S. cerevisiae.(From reference <ref name="ref2" />).'']]
Line 25: Line 25:
  
 
===Evolution===
 
===Evolution===
−
There are three known classes of methyltransferases in plants: MET1, a homologue of mammalian DNMT1; CMT3, a plant-specific DNA methyltransferase; and DRM2, a de novo methyltransferase. MET1 is primarily responsible for the maintenance of established CG methylation. CMT3 possesses a chromodomain catalytic motif and specifically maintains the methylation of hemimethylated CHG sites. Both MET1 and CMT3 belong to the family of maintenance DNA methyltransferases. DRM is a homologue of human DNMT3, it can methylate both unmethylated and hemimethylated cytosine nucleotides in any sequence context <ref name="ref2" />. OsDRM2  is homologous to the Arabidopsis DRM2 gene. We can see the phylogeny of rice cytosine DNA MTases from Fig 7<ref name="ref6" />.
+
There are three known classes of methyltransferases in plants: MET1, a homologue of mammalian DNMT1; CMT3, a plant-specific DNA methyltransferase; and DRM2, a de novo methyltransferase. MET1 is primarily responsible for the maintenance of established CG methylation. CMT3 possesses a chromodomain catalytic motif and specifically maintains the methylation of hemimethylated CHG sites. Both MET1 and CMT3 belong to the family of maintenance DNA methyltransferases. DRM is a homologue of human DNMT3, it can methylate both unmethylated and hemimethylated cytosine nucleotides in any sequence context <ref name="ref2" />. ''OsDRM2'' is homologous to the Arabidopsis DRM2 gene. We can see the phylogeny of rice cytosine DNA MTases from Fig 7<ref name="ref6" />.
 
[[File:Fig.7 OsDRM2.png|right|thumb|250px|Fig.7 Phylogeny of rice cytosine DNA MTases. (From reference <ref name="ref6" />).'']]
 
[[File:Fig.7 OsDRM2.png|right|thumb|250px|Fig.7 Phylogeny of rice cytosine DNA MTases. (From reference <ref name="ref6" />).'']]
  
 
===Knowledge Extension===
 
===Knowledge Extension===
 
[[File:Fig.8 OsDRM2.JPG|right|thumb|250px|Fig.8 In vivo and in vitro interaction between OsDRM2 and OseIF4A.(From reference <ref name="ref7" />).'']]
 
[[File:Fig.8 OsDRM2.JPG|right|thumb|250px|Fig.8 In vivo and in vitro interaction between OsDRM2 and OseIF4A.(From reference <ref name="ref7" />).'']]
−
Deletion analysis reveals that interaction between OsDRM2 and OseIF4A is specifically mediated through ubiquitin-associated domain of OsDRM2 while, both domains 1 and 2 of OseIF4A are critical for mediating strong interaction with OsDRM2 in vivo. Interaction between Arabidopsis eIF4AI and eIF4AII with OsDRM2 and nuclear localization of these complexes suggests possible conservation of functional interaction betweende novomethyltransferases and the translation initiation factor, eIF4A, in RdDM across plant species(Fig8)<ref name="ref7" />.
+
Deletion analysis reveals that interaction between ''OsDRM2'' and ''OseIF4A'' is specifically mediated through ubiquitin-associated domain of OsDRM2 while, both domains 1 and 2 of ''OseIF4A'' are critical for mediating strong interaction with OsDRM2 in vivo. Interaction between Arabidopsis eIF4AI and eIF4AII with ''OsDRM2'' and nuclear localization of these complexes suggests possible conservation of functional interaction betweende novomethyltransferases and the translation initiation factor, eIF4A, in RdDM across plant species(Fig8)<ref name="ref7" />.
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 14:17, 21 May 2014

OsDRM2(Os03g0110800) is the major DRM1/2-type methyltransferase gene in rice.

Annotated Information

Function

OsDRM2(Os03g0110800) is the major DRM1/2-type methyltransferase gene in rice. OsDRM2 is responsible for de novo, CG and non-CG methylation in rice genomic sequences, and that DNA methylation regulated by OsDRM2 is essential for proper rice development in both vegetative and reproductive stages[1].

1. Targeted disruptants of rice OsDRM2 displayed pleiotropic developmental phenotypes in both vegetative and reproductive stages, including growth defects, semi-dwarfed stature, reductions in tiller number, delayed heading or no heading, abnormal panicle and spikelet morphology, and complete sterility(Fig 1)[1].

2. OsDRM2 is required not only for DNA methylation ofRIRE7/CRR1sequences and5S rDNA repeats, but also for transcriptional silencing of RIRE7/CRR1 retrotransposons(Fig 2)[1].

3. Impaired growth and abnormal DNA methylation of osdrm2 disruptants were restored by the complementation of wild-type OsDRM2 cDNA(Fig 3)[1].

Fig.1 Phenotype analyses of rice osdrm2 disruptants.(From reference [1]).
Fig.2 Expression of  RIRE7/CRR1 retrotransposons and DNA methylation status of repetitive sequences in osdrm2 disruptants.(From reference [1]).
Fig.3 Complementation of the  osdrm2 disruptants by ectopic expression of OsDRM2 cDNA.(From reference [1]).

Expression

1. RT-PCR analysis revealed that OsDRM2 is expressed constitutively. OsDRM2 encodes a protein of 584 amino acids, containing two ubiquitin-associated (UBA) domains and conserved catalytic domains(Fig 4)[1].

2. Peng. et al. cloned and expressed one of these homologues,OsDRM2(DMT706), in both E. coli and S.cerevisiae. De novo methylation activity was present in the transformants of both organisms. The recombinant OsDRM protein can methylate any type of cytosine nucleotide, including those in the patterns CG, CHG, and CHH. Evidence of cytosine methylation was observed in the genomic DNA of S. cerevisiae that expressed the OsDRM2 gene based on MSAP assays, bisulfite sequencing and a test of cytosine methylation by endonuclease digestion. This evidence demonstrated that the OsDRM2 protein can not only methylate cytosine nucleotidesin vivo in an RdDM pathway-free cellular environment but can also methylate cytosine nucleotides in vitro(Fig 5)[2].

3. Non-coding RNAs, especially small RNAs, play important roles in the expression of OsDRM2. For instance, miR820 negatively regulates the expression of OsDRM2[3][4][5]. And expression levels of various TEs are increased quite sensitively in response to decreased OsDRM2 expression and DNA methylation at TE loci(Fig 6)[3].

Fig.4 RT-PCR expression analysis of  OsDRM genes in rice. (From reference [1]).
Fig.5 MSAP analysis of genomic DNA from pBOsDRM2-transformed S. cerevisiae.(From reference [2]).
Fig.6 OsDRM2 is negatively regulated by miR820.(From reference [3]).

Evolution

There are three known classes of methyltransferases in plants: MET1, a homologue of mammalian DNMT1; CMT3, a plant-specific DNA methyltransferase; and DRM2, a de novo methyltransferase. MET1 is primarily responsible for the maintenance of established CG methylation. CMT3 possesses a chromodomain catalytic motif and specifically maintains the methylation of hemimethylated CHG sites. Both MET1 and CMT3 belong to the family of maintenance DNA methyltransferases. DRM is a homologue of human DNMT3, it can methylate both unmethylated and hemimethylated cytosine nucleotides in any sequence context [2]. OsDRM2 is homologous to the Arabidopsis DRM2 gene. We can see the phylogeny of rice cytosine DNA MTases from Fig 7[6].

Fig.7 Phylogeny of rice cytosine DNA MTases. (From reference [6]).

Knowledge Extension

Fig.8 In vivo and in vitro interaction between OsDRM2 and OseIF4A.(From reference [7]).

Deletion analysis reveals that interaction between OsDRM2 and OseIF4A is specifically mediated through ubiquitin-associated domain of OsDRM2 while, both domains 1 and 2 of OseIF4A are critical for mediating strong interaction with OsDRM2 in vivo. Interaction between Arabidopsis eIF4AI and eIF4AII with OsDRM2 and nuclear localization of these complexes suggests possible conservation of functional interaction betweende novomethyltransferases and the translation initiation factor, eIF4A, in RdDM across plant species(Fig8)[7].

Labs working on this gene

  • National Institute for Basic Biology, Okazaki 444-8585, Japan
  • Key Laboratory of Molecular Epigenetics of the Ministry of Education, Northeast Normal University, Changchun, Jilin 130024, PR China
  • Interdisciplinary Centre for Plant Genomics and Department of Plant Molecular Biology, University of Delhi South Campus, New Delhi, India
  • Department of Biological Mechanisms and Functions, Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya, Japan
  • State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China
  • University School of Biotechnology, Guru Gobind Singh Indraprastha University, Sector 16C, Dwarka, New Delhi 110078, India

References

  1. ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 Moritoh, S., Eun, C. H., Ono, A., et al. (2012). Targeted disruption of an orthologue of DOMAINS REARRANGED METHYLASE 2, OsDRM2, impairs the growth of rice plants by abnormal DNA methylation. The Plant Journal, 71(1), 85-98. PMID 22380881
  2. ↑ 2.0 2.1 2.2 Pang, J., Dong, M., Li, N., et al. (2013). Functional characterization of a rice de novo DNA methyltransferase, OsDRM2, expressed in Escherichia coli and yeast. Biochemical and biophysical research communications, 432(1), 157-162.PMID 23357425
  3. ↑ 3.0 3.1 3.2 Nosaka, M., Itoh, J. I., Nagato, Y., et al. (2012). Role of transposon-derived small RNAs in the interplay between genomes and parasitic DNA in rice. PLoS genetics, 8(9), e1002953.PMID 23028360
  4. ↑ Wei, L., Gu, L., Song, X., et al.. (2014). Dicer-like 3 produces transposable element-associated 24-nt siRNAs that control agricultural traits in rice. Proceedings of the National Academy of Sciences, 111(10), 3877-3882.PMID 24554078
  5. ↑ Arikit, S., Zhai, J., & Meyers, B. C. (2013). Biogenesis and function of rice small RNAs from non-coding RNA precursors. Current opinion in plant biology, 16(2), 170-179.PMID 23466255
  6. ↑ 6.0 6.1 Sharma, R., Mohan Singh, R. K., Malik, G., et al. (2009). Rice cytosine DNA methyltransferases–gene expression profiling during reproductive development and abiotic stress.FEBS journal, 276(21), 6301-6311.PMID 19788421
  7. ↑ 7.0 7.1 Dangwal, M., Malik, G., Kapoor, S., et al. (2013). De Novo Methyltransferase, OsDRM2, Interacts with the ATP-Dependent RNA Helicase, OseIF4A, in Rice. Journal of molecular biology, 425(16), 2853-2866.PMID 23732981

Structured Information

Gene Name

Os03g0110800

Description

Similar to DNA methyltransferase

Version

NM_001055253.1 GI:115450234 GeneID:4331357

Length

3670 bp

Definition

Oryza sativa Japonica Group Os03g0110800, complete gene.

Source

Oryza sativa Japonica Group 

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:611011..614680

Sequence Coding Region

611181..611186,611747..611869,611985..612084,612169..612215,612294..612452
,613035..613131,613211..613302,613392..614561

Expression

GEO Profiles:Os03g0110800

Genome Context

<gbrowseImage1> name=NC_008396:611011..614680 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:611011..614680 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggtggactgggcttcagatagcgacaatgataagttcgagtgggacacagacggtgaggctgagacctcatctgccccggccctaaggaacatagatgctcctggtccgtccacgaggctgccgcaggatgcaaatgggaaggccaacgggtcaggtgctttggttgctgaatttatgggaatgggattcccaaaagaaatgatcttgaaagcgattaaggagattggggatacagatacagagcaattgcttgagttacttctgacttatcaggcaataggcggtgacgcttcagtgggtaactgctctgcttcggcctgtgccccccagactcttgaagtcgacgaggaggaggatgatactaattgggatgaatatgatactgctggcaattgtgacaggactcctcactctgatggttctggtgacgaggatttctttcaagaaatgtcagagaaggatgaaaaaatgaagtccttagtcaacatgggttttcctgaagatgaagcaaagatggctatcgatagatgtctcgatgcgcctgtagcagtgttggttgattcaatctatgcatcacaggaagcaggaaatggttactctgcaaacttatctgactatgaggatacagagttcagttcctttggaggaagaaagaaaacaagatttgtggatggaagcaagaagagaaagcggtatggaagtgggccatctgggaatcaagtgccgtttgatggcagccacgaagagcccatgcctcttccaaatccaatggtgggattcagcttgcccaatgagaggttaaggtcagtccacagaaatcttcctgaccaagctcttgggccaccattcttttactatgaaaacgtggccctagctccaaaaggtgtatggacaaccatctcaaggtttttatatgacattcagcctgagtttgtggactccaagtacttttgtgctgctgccaggaagaggggttatattcataacctgccgattgagaacaggtcacctgttctcccaatgcctcccaaaacaatatctgaagcctttcctaataccaagaggtggtggccttcctgggatccaaggaggcagttcaactgcttgcaaacttgtatggcaagcgcaaagcttacagagcgaattcgttgtgctttgggtagattcagtgatgtaccaactccacaagttcagaagtatgtcttggacgaatgtaggaaatggaacctagtttgggtcggaaagaataaggtcgctcctctagagcctgatgagatggagttcctgttagggtaccctagaaaccacactaggggagttagcaggacggagaggtacagggctctcgggaattcattccaagttgatacagtagcataccatctctctgtgctgagggacctgtttcccaatggaatgaatgtcttatccctgttttctggtattggaggagcagaggtagctctccacagactggggatacatatgaaaacagtgatctctgttgagaaatcagaagtgaacagaacgattctgaagagctggtgggatcagacacaaactggaacgctgattgaaatcgccgacgtgcggcatcttactactgaaagaattgaaacattcatcagaaggtttggcggttttgacctggtgattggtggcagcccgtgcaacaaccttgctggcagcaaccgccatcaccgagatggtctggagggcgagcactccgcgctcttctacgattacattagaatattagaacatgtaaaggctaccatgtcagcagtctag</cdnaseq>

Protein Sequence

<aaseq>MVDWASDSDNDKFEWDTDGEAETSSAPALRNIDAPGPSTRLPQD ANGKANGSGALVAEFMGMGFPKEMILKAIKEIGDTDTEQLLELLLTYQAIGGDASVGN CSASACAPQTLEVDEEEDDTNWDEYDTAGNCDRTPHSDGSGDEDFFQEMSEKDEKMKS LVNMGFPEDEAKMAIDRCLDAPVAVLVDSIYASQEAGNGYSANLSDYEDTEFSSFGGR KKTRFVDGSKKRKRYGSGPSGNQVPFDGSHEEPMPLPNPMVGFSLPNERLRSVHRNLP DQALGPPFFYYENVALAPKGVWTTISRFLYDIQPEFVDSKYFCAAARKRGYIHNLPIE NRSPVLPMPPKTISEAFPNTKRWWPSWDPRRQFNCLQTCMASAKLTERIRCALGRFSD VPTPQVQKYVLDECRKWNLVWVGKNKVAPLEPDEMEFLLGYPRNHTRGVSRTERYRAL GNSFQVDTVAYHLSVLRDLFPNGMNVLSLFSGIGGAEVALHRLGIHMKTVISVEKSEV NRTILKSWWDQTQTGTLIEIADVRHLTTERIETFIRRFGGFDLVIGGSPCNNLAGSNR HHRDGLEGEHSALFYDYIRILEHVKATMSAV</aaseq>

Gene Sequence

<dnaseqindica>171..176#737..859#975..1074#1159..1205#1284..1442#2025..2121#2201..2292#2382..3551#aacgccgtgtggtcgccatcgccatcgccttcctcctcctcctcctccgccgccgcgcgcttcctcgccaccgcgcgcccagggccatcggcggcggacgccctcgcccacgcgcgcgagagaggggggcgagagattatcggacgagtcgctttgcggagctttctagaatggtggtaagggctcccgctccccccctccgaagcctcctcttcctctctcctccaatctccatcctgctgctgctgcatgatgttagtttggccgtgccgcggcggacgaccctcctcgtcgttgttcgtggattgctccgtgcacgattaggttgtgggtttccgtttgggattgggatggaggggctcctctggtctgtttagtcgcgaaagaatgatactttcttgtatgttttgctgcattttggatcctaaaattatctgatactgtattgatgtcgcgcttgagaattcgattttgcgatgtcgcgtgaacagttcgggcttgcggagcgtggaggagcagaatatttccccccttttgatttggatttagggtttaactgtttggctatccccttgaaatttgatgagggctacgtgatataggggtggcagtatgcctcatacaagatgctacattcaacccgattcagtacttgcgttaatttttctcctctgaatcgccttgttttcactgttagtcgggatatttcagacgtgttgcttaatttatgtcacaggactgggcttcagatagcgacaatgataagttcgagtgggacacagacggtgaggctgagacctcatctgccccggccctaaggaacatagatgctcctggtccgtccacgaggctgccgcaggtaggagatagaggtctatctttgaacacacgtgctagtcatttgttcaaaccatgttgttactttactgtaattataatcaaaatgtggtgtttgtttgtggaactgtctgaaggatgcaaatgggaaggccaacgggtcaggtgctttggttgctgaatttatgggaatgggattcccaaaagaaatgatcttgaaagcgattaaggagattggtaacgataacaataatctagttctcttatttgcttctggttgcattttgaatcttctgtttcaactgctgtcttttctttcaggggatacagatacagagcaattgcttgagttacttctgacttatcaggtatttgcccacatggttgcatcactctgtttattattatctaatgctctactgtacaagtgatgccgtgtaatgcaggcaataggcggtgacgcttcagtgggtaactgctctgcttcggcctgtgccccccagactcttgaagtcgacgaggaggaggatgatactaattgggatgaatatgatactgctggcaattgtgacaggactcctcactctgatggttctggtgacgaggtatttacatgaccccctccttggtcattatatatttatatgcacttgctgtgtctatttcttgaccagtttccctgatcatggctgcaccattttttgcacttgcttcatgctaagaacacattcccttattaatacctatgtaagtgaactactggtcgtataataaattagaaaatttcatacctgtgttctatttcactcttagtaaacaagtatagatatggttagctatactgcagtgctgtagtcttttgtatctataaaaccatacatgtccctgtagggttgttaaaggagctttgttgatccagcccttccttccatcattctatgcatctccagttagcattttctttatggtgcctttgtagtgagagttagcagaactactgtagaaccatcagagagaggatcatatatttggtagcagtaaattgtaggctttgcaaatggtatatgtgtataactgtatatgtgatgcctgcattagttgctttattaataggttattctggactgcaagtcattagagagatgtaacaagtgttttcaatttgcctttaatgtgcttttatgcaggatttctttcaagaaatgtcagagaaggatgaaaaaatgaagtccttagtcaacatgggttttcctgaagatgaagcaaagatggctatcgatagatgtggtatgcctctattgaatttgatgctttgacaggaaggaaccttattctgctgcctttgttggcttaaatttcccaggtctcgatgcgcctgtagcagtgttggttgattcaatctatgcatcacaggaagcaggaaatggttactctgcaaacttatctgactatgaggtaccttgtgattataatgcatctgaatcaataggttgtttcatttcattaaatataacggcattggcatcatctttataattgtgcaggatacagagttcagttcctttggaggaagaaagaaaacaagatttgtggatggaagcaagaagagaaagcggtatggaagtgggccatctgggaatcaagtgccgtttgatggcagccacgaagagcccatgcctcttccaaatccaatggtgggattcagcttgcccaatgagaggttaaggtcagtccacagaaatcttcctgaccaagctcttgggccaccattcttttactatgaaaacgtggccctagctccaaaaggtgtatggacaaccatctcaaggtttttatatgacattcagcctgagtttgtggactccaagtacttttgtgctgctgccaggaagaggggttatattcataacctgccgattgagaacaggtcacctgttctcccaatgcctcccaaaacaatatctgaagcctttcctaataccaagaggtggtggccttcctgggatccaaggaggcagttcaactgcttgcaaacttgtatggcaagcgcaaagcttacagagcgaattcgttgtgctttgggtagattcagtgatgtaccaactccacaagttcagaagtatgtcttggacgaatgtaggaaatggaacctagtttgggtcggaaagaataaggtcgctcctctagagcctgatgagatggagttcctgttagggtaccctagaaaccacactaggggagttagcaggacggagaggtacagggctctcgggaattcattccaagttgatacagtagcataccatctctctgtgctgagggacctgtttcccaatggaatgaatgtcttatccctgttttctggtattggaggagcagaggtagctctccacagactggggatacatatgaaaacagtgatctctgttgagaaatcagaagtgaacagaacgattctgaagagctggtgggatcagacacaaactggaacgctgattgaaatcgccgacgtgcggcatcttactactgaaagaattgaaacattcatcagaaggtttggcggttttgacctggtgattggtggcagcccgtgcaacaaccttgctggcagcaaccgccatcaccgagatggtctggagggcgagcactccgcgctcttctacgattacattagaatattagaacatgtaaaggctaccatgtcagcagtctagtttaagctatcacattaactaactctgtgatttattgttgttaacgaagttagaacctgttgattgatattgctgaacctgatgtgatgttattgcactcaaacaggagtgttttttcc</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0110800, RefSeq:Os03g0110800

Retrieved from "https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os03g0110800&oldid=170567"