Difference between revisions of "Os06g0165600"
(→Annotated Information) |
(→Annotated Information) |
||
| Line 4: | Line 4: | ||
===Function=== | ===Function=== | ||
The '''''OsDREB1D''''', a special DREB (dehydration responsive element binding protein) homologous gene, whose transcripts cannot be detected in rice (Oryza sativa L), either with or without stress treatments, was amplified from the rice genome DNA.<ref name="ref1" /><ref name="ref2" /><ref name="ref3" />. The over-expression of '''''OsDREB1D''''',a gene encoding a protein that is the closest homolog of the C-repeat (CRT)binding factor/dehydration-responsiveelementbinding protein 1(CBF/DREB1) in rice, conferred cold and high-salt tolerance in transgenic plants, and that transgenic plants were also insensitive to ABA (abscisic acid).<ref name="ref1" /><ref name="ref3" /><ref name="ref4" /><ref name="ref5" />. This '''''OsDREB1D''''' gene functions similarly as other DREB transcription factors <ref name="ref1" />. | The '''''OsDREB1D''''', a special DREB (dehydration responsive element binding protein) homologous gene, whose transcripts cannot be detected in rice (Oryza sativa L), either with or without stress treatments, was amplified from the rice genome DNA.<ref name="ref1" /><ref name="ref2" /><ref name="ref3" />. The over-expression of '''''OsDREB1D''''',a gene encoding a protein that is the closest homolog of the C-repeat (CRT)binding factor/dehydration-responsiveelementbinding protein 1(CBF/DREB1) in rice, conferred cold and high-salt tolerance in transgenic plants, and that transgenic plants were also insensitive to ABA (abscisic acid).<ref name="ref1" /><ref name="ref3" /><ref name="ref4" /><ref name="ref5" />. This '''''OsDREB1D''''' gene functions similarly as other DREB transcription factors <ref name="ref1" />. | ||
| − | [[File:Figure 1. Over-expression of '''''OsDREB1D''''' and high-salt tolerance analysis in transgenic plants. (A) Over-expression of '''''OsDREB1D''''' gene was analyzed in transgenic Arabidopsis | + | [[File:Figure 1. Over-expression of '''''OsDREB1D''''' and high-salt tolerance analysis in transgenic plants. (A) Over-expression of '''''OsDREB1D''''' gene was analyzed in transgenic Arabidopsis.jpg|right|thumb|150px|Figure 1. Over-expression of '''''OsDREB1D''''' and high-salt tolerance analysis in transgenic plants. (A) Over-expression of '''''OsDREB1D''''' gene was analyzed in transgenic Arabidopsis.(from reference <ref name="ref1" />).'']] |
===Mutation=== | ===Mutation=== | ||
Revision as of 08:00, 22 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
The OsDREB1D, a special DREB (dehydration responsive element binding protein) homologous gene, whose transcripts cannot be detected in rice (Oryza sativa L), either with or without stress treatments, was amplified from the rice genome DNA.[1][2][3]. The over-expression of OsDREB1D,a gene encoding a protein that is the closest homolog of the C-repeat (CRT)binding factor/dehydration-responsiveelementbinding protein 1(CBF/DREB1) in rice, conferred cold and high-salt tolerance in transgenic plants, and that transgenic plants were also insensitive to ABA (abscisic acid).[1][3][4][5]. This OsDREB1D gene functions similarly as other DREB transcription factors [1].
Mutation
To identify genes involved in the control of rice tillering, Li et al. have screened for mutants with altered tiller numbers from collections derived from spontaneous mutations or g-ray radiation and ethyl methanesulphonate (EMS) mutagenesis, and they found that moc1 plants nearly completely lose their tillering ability after a spontaneous moc1 mutant, producing only one main culm, in contrast to the multiple tillers in wild-type plants[1]. They amplified the corresponding ORF from moc1 and wild-type plants with polymerase chain reaction (PCR) and sequenced it. DNA sequence comparison revealed a 1.9-kb retrotransposon inserted in this ORF in the moc1 mutant. Confirmation of the retrotransposon-interrupted ORF as MOC1 was achieved by functional complementation[1]. Genetic analysis with reciprocal crosses between moc1 and wild-type plants revealed that moc1 possesses a recessive mutation in a single nuclear locus[1]. We can see the effects of moc1 mutant on rice tillering from the following picture 2.
Expression
The MOC1 spatial and temporal expression patterns revealed by RNA in situ hybridization are consistent with the function of MOC1 for axillary meristem initiation and tiller bud formation. MOC1 expression is detectable in a small number of epidermal or subepidermal cells at the leaf axils before any visible morphological changes at the position where axillary meristems will initiate. Thereafter, MOC1 is mainly expressed in the protuberance and axillary meristem and extended to the entire tiller bud including the axillary leaf primordia and young leaves, whereas no signal could be observed in the shoot apical meristem (SAM) [1]. Slight overexpression of the MOC1 gene can increased tiller number and reduced plant height[1].
| Primer | Forward primer | Reverse primer |
|---|---|---|
| Gene amplication | 5’ -TCGTTGTAGTAGCTCT GGTG-3’ | 5’-CTAACTAGAGATCGAGTAGC-3'[1] |
| RT-PCR | 5'-AGACGCTCGCCGTGAACT-3' | 5'-GCCTTCACCCACTTCAAGA-3'[6] |
Evolution
MONOCULM1(MOC1) genomic regions were sequenced and compared across 14 Oryza genomes by Lu et al, and the result of genomic alignment of the MOC1 region in 18 Oryza genomes or subgenomes can be seen from Fig.3[2].
Sequencing and annotation of the MOC1 region of the 14 Oryza species, including 10 diploids and 4 allotetraploids, revealed highly conserved gene colinearity and structure in the MOC1 region[2]. Large and apparently noncoding sequences flanking the MOC1 gene were observed to be under strong purifying selection[2]. MOC1 is highly homologous with the tomato Lateral suppressor (Ls) gene. Rice MONOCULM1 (MOC1) and Arabidopsis LATERAL SUPPRESSOR (LAS) are orthologs, which play important roles in axillary meristems initiation in rice and Arabidopsis[1][7].
Knowledge Extension
TEOSINTE BRANCHED1 (TB1) encodes a putative transcription factor of the TCP protein family, and impairment of TB1 leading to enhance lateral branching in maize suggests its negative regulatory role in controlling the axillary bud outgrowth[8][9]. The rice ortholog OsTB1/FINE CULM1 (FC1) shows similar characteristics and therefore also negatively regulates rice tillering [10]. Consistent with the function of TB1 in maize, overexpression of OsTB1 reduces rice tillers severely while its loss-of-function mutation in the classical mutant fine culm (fcn1) promotes the outgrowth of rice tillers[11]. The results reveal that the pivotal role of OsTB1 is to control the outgrowth of rice tiller buds rather than the initiation of tiller buds[10]. D10 also functions as a negative regulator and works independently of OsTB1/FC1 in rice[12].
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os06g0165600 |
|---|---|
| Description |
CRT/DRE binding factor (Transcription factor RCBF4) |
| Version |
NM_001063444.1 GI:115466619 GeneID:4340239 |
| Length |
904 bp |
| Definition |
Oryza sativa Japonica Group Os06g0165600, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:3309920..3310823 |
| Sequence Coding Region |
3309944..3310705 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008399:3309920..3310823 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008399:3309920..3310823 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggagaagaacaccgccgccagcgggcaattgatgacctcctccgcggaggcgacgccgtcgtcgccgaagcggccggcggggcgaaccaagttccaggagacgaggcacctagtgttccgtggggtgcgatggcgtgggtgcgcggggcggtgggtgtgcaaggtgcgtgtcccgggcagccgcggtgaccgtttctggataggcacgtctgacaccgccgaggagaccgcgcgcacgcacgacgccgccatgctcgccttgtgcggggcctccgccagcctcaacttcgccgactctgcctggctgctccacgtcccgcgcgcccccgtcgtctccggactccggccaccagctgcccgatgtgcaacgcgctgcctgcaaggccatcgccgagttccagcgccgggccgggggagcaccgccactgccactgccacctccggcgatgctgcatcgaccgctcctccgtcggcacccgttctgtcagccaaacaatgcgaattcatctttctttcttcactagattgttggatgttaatgtcaaagcttatcagcagtagcagagcaaaaggatcgttgtgcctgcgaaaaaatcccatttcattttgcatggttacaaattcttacactgctcttttgctcgaatacattatattgcagatgaattcaatgatcgttttaatccacgaattatcaaaatatcaagtctttctgctactaaccatgataacacaccacctttttcaatggaggaggtag</cdnaseq> |
| Protein Sequence |
<aaseq>MEKNTAASGQLMTSSAEATPSSPKRPAGRTKFQETRHLVFRGVR WRGCAGRWVCKVRVPGSRGDRFWIGTSDTAEETARTHDAAMLALCGASASLNFADSAW LLHVPRAPVVSGLRPPAARCATRCLQGHRRVPAPGRGSTATATATSGDAASTAPPSAP VLSAKQCEFIFLSSLDCWMLMSKLISSSRAKGSLCLRKNPISFCMVTNSYTALLLEYI ILQMNSMIVLIHELSKYQVFLLLTMITHHLFQWRR</aaseq> |
| Gene Sequence |
<dnaseqindica>25..786#actgcttgagacgtcgcacacgtcatggagaagaacaccgccgccagcgggcaattgatgacctcctccgcggaggcgacgccgtcgtcgccgaagcggccggcggggcgaaccaagttccaggagacgaggcacctagtgttccgtggggtgcgatggcgtgggtgcgcggggcggtgggtgtgcaaggtgcgtgtcccgggcagccgcggtgaccgtttctggataggcacgtctgacaccgccgaggagaccgcgcgcacgcacgacgccgccatgctcgccttgtgcggggcctccgccagcctcaacttcgccgactctgcctggctgctccacgtcccgcgcgcccccgtcgtctccggactccggccaccagctgcccgatgtgcaacgcgctgcctgcaaggccatcgccgagttccagcgccgggccgggggagcaccgccactgccactgccacctccggcgatgctgcatcgaccgctcctccgtcggcacccgttctgtcagccaaacaatgcgaattcatctttctttcttcactagattgttggatgttaatgtcaaagcttatcagcagtagcagagcaaaaggatcgttgtgcctgcgaaaaaatcccatttcattttgcatggttacaaattcttacactgctcttttgctcgaatacattatattgcagatgaattcaatgatcgttttaatccacgaattatcaaaatatcaagtctttctgctactaaccatgataacacaccacctttttcaatggaggaggtaggcgcggacgccctcgccatcatcgtcgatgtcgccactgatgacgaggtccgcgccgctcaccagctcgcacgcctcgtcgtcgtccatgctcgccacctcggtccagcagctgaacc</dnaseqindica> |
| External Link(s) |
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 1.11 Cite error: Invalid
<ref>tag; no text was provided for refs namedref1 - ↑ 2.0 2.1 2.2 2.3 2.4 Cite error: Invalid
<ref>tag; no text was provided for refs namedref2 - ↑ 3.0 3.1 Cite error: Invalid
<ref>tag; no text was provided for refs namedref3 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref4 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref5 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref8 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref9 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref10 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref11 - ↑ 10.0 10.1 Cite error: Invalid
<ref>tag; no text was provided for refs namedref12 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref7 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref13