Difference between revisions of "Os10g0100200"

From RiceWiki
Jump to: navigation, search
(Function)
Line 2: Line 2:
  
 
==Annotated Information==
 
==Annotated Information==
===Function===
+
This gene encodes an Hypothetical protein. Some hypothetical proteins are well conserved among many organisms and presumably perform a common biological role that is as yet undefined. The other hypothetical proteins are specific to only one organism where they exert a specialized role. Functional assignment of hypothetical proteins is, therefore, indispensable for understanding the fundamental or specific biological phenomena of diverse organisms. Because the threedimensional structure of a protein is very important for the understanding of its function at the molecular level, structural analysis of hypothetical proteins can give valuable functional clues that may not be evident from sequence data alone.
Please input function information here.
 
  
 
===Expression===
 
===Expression===

Revision as of 13:18, 22 May 2014

Please input one-sentence summary here.

Annotated Information

This gene encodes an Hypothetical protein. Some hypothetical proteins are well conserved among many organisms and presumably perform a common biological role that is as yet undefined. The other hypothetical proteins are specific to only one organism where they exert a specialized role. Functional assignment of hypothetical proteins is, therefore, indispensable for understanding the fundamental or specific biological phenomena of diverse organisms. Because the threedimensional structure of a protein is very important for the understanding of its function at the molecular level, structural analysis of hypothetical proteins can give valuable functional clues that may not be evident from sequence data alone.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os10g0100200

Description

Hypothetical protein

Version

NM_001070542.1 GI:115480827 GeneID:4347934

Length

791 bp

Definition

Oryza sativa Japonica Group Os10g0100200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 10

Location

Chromosome 10:23934..24724

Sequence Coding Region

24293..24559

Expression

GEO Profiles:Os10g0100200

Genome Context

<gbrowseImage1> name=NC_008403:23934..24724 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:23934..24724 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtgcacggatttgccgccgcctgcttctcccctttcatcgtcgtcgtctacttgctgcacgagcccacctcgcgcacacggatttctcccacccccttcccccttgccgcctccgatgcctttgcctcgcgtgcgcacagttccaccttcgccgtcgccgaagaggcgctcggtgatacctgcgggagaaagaggaaggaggggagaggaggaagaagaagcagcgactgacatgtggggacccactgtgatagacttaaaatag</cdnaseq>

Protein Sequence

<aaseq>MCTDLPPPASPLSSSSSTCCTSPPRAHGFLPPPSPLPPPMPLPR VRTVPPSPSPKRRSVIPAGERGRRGEEEEEAATDMWGPTVIDLK</aaseq>

Gene Sequence

<dnaseqindica>360..626#aggagcacggggaggagcactgctatggcaggtgaagacggtgcccgccccgccgctcgccgcagcctgccatagcatcatcctctggccgccctgccgccgcagccgccggcctccgctcgctacagcccgccgcctccgctcaccgcagccgttaccccgcctccgcccgccccgccactcgctgcaacctgtcacctcgcagcctgacgacggtgtcgaggtgggagaagggagacaaggcggcgtgaagggagtggtggcgctagcgagataggaaatgaggcggcagtggggccggcttcccctttcgccgtcgccgtagtcttcgtcatccctcgccgtcgccgtcgactcgcatgtgcacggatttgccgccgcctgcttctcccctttcatcgtcgtcgtctacttgctgcacgagcccacctcgcgcacacggatttctcccacccccttcccccttgccgcctccgatgcctttgcctcgcgtgcgcacagttccaccttcgccgtcgccgaagaggcgctcggtgatacctgcgggagaaagaggaaggaggggagaggaggaagaagaagcagcgactgacatgtggggacccactgtgatagacttaaaatagagtgggtagatggagaggctgttggagcgagtaagtagtttgactagccaaataagatggagagttggctatatgggtgtttggagagtccgatttggagaggctattggagatgctcttataactgatgagaattaattacagaatgataaaggtttagttgtc</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0100200, RefSeq:Os10g0100200