Difference between revisions of "Os01g0201700"

From RiceWiki
Jump to: navigation, search
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
'''OsMADS3'''(Os01g0201700)plays key roles in both stamen identity specification and late anther development ,and Loss-of-function mutants of OSMADS3 result severe defects in stamen identity and lodicule number[1][2].MADS3 is highly expressed in the tapetum and microspores during late anther development and is a key transcriptional regulator that functions in rice male reproductive development, at least in part, by modulating ROS levels through MT-1-4b[1].  
+
'''OsMADS3'''(Os01g0201700)plays key roles in both stamen identity specification and late anther development ,and Loss-of-function mutants of OSMADS3 result severe defects in stamen identity and lodicule number<ref name="ref1" /><ref name="ref2" />.MADS3 is highly expressed in the tapetum and microspores during late anther development and is a key transcriptional regulator that functions in rice male reproductive development, at least in part, by modulating ROS levels through MT-1-4b<ref name="ref1" />.  
  
OsMADS3 plays a synergistic role with OsMADS13 in both ovule development and floral meristem termination[3].OsMADS3 represses the expression of the putative A-class gene DEP (OsMADS15)[3].OSMADS3 and OSMADS58 have been subfunctionalized such that they play more predominant roles in distinct whorls[2].The expression of MADS3 and MADS58 can be activated by MADS6 to regulates the stamen, carpel, and meristem identities at early stages and specifies carpel/ovule development[4].
+
OsMADS3 plays a synergistic role with OsMADS13 in both ovule development and floral meristem termination<ref name="ref3" />.OsMADS3 represses the expression of the putative A-class gene DEP (OsMADS15)<ref name="ref3" />.OSMADS3 and OSMADS58 have been subfunctionalized such that they play more predominant roles in distinct whorls<ref name="ref2" />.The expression of MADS3 and MADS58 can be activated by MADS6 to regulates the stamen, carpel, and meristem identities at early stages and specifies carpel/ovule development[<ref name="ref4" />.
 
===Mutation===
 
===Mutation===
 
MADS3 alleles:mads3-1,mads3-2,mads3-3,mads3-4.
 
MADS3 alleles:mads3-1,mads3-2,mads3-3,mads3-4.
mads3-1 is a weak allele carrying an insertion in the C-terminal region of the gene and showing no defective floral organs, whereas mads3-2 is an intermediate allele with a mutation at the C terminus of the K-domain and reduced expression of the gene, which resulted in mild transformation of stamens into lodicules[2]. mads3-3 is a strong allele in the Dongjin (a japonica cultivar) background. It contains a T-DNA insertion in the second intron of the gene, which leads to no detectable MADS3 transcript and homeotic transformation of nearly all stamens in whorl 3 into lodicule-like organs [2]. mads3-4, which results in a mutation in the middle region of the K-domain of MADS3, seems to be another intermediate mutant with reduced expression of MADS3 [1].
+
mads3-1 is a weak allele carrying an insertion in the C-terminal region of the gene and showing no defective floral organs, whereas mads3-2 is an intermediate allele with a mutation at the C terminus of the K-domain and reduced expression of the gene, which resulted in mild transformation of stamens into lodicules<ref name="ref2" />. mads3-3 is a strong allele in the Dongjin (a japonica cultivar) background. It contains a T-DNA insertion in the second intron of the gene, which leads to no detectable MADS3 transcript and homeotic transformation of nearly all stamens in whorl 3 into lodicule-like organs <ref name="ref2" />. mads3-4, which results in a mutation in the middle region of the K-domain of MADS3, seems to be another intermediate mutant with reduced expression of MADS3 <ref name="ref1" />.
  
 
===Expression===
 
===Expression===
Expression of OSMADS3 was first detected at the time when the lemma and palea primordia were just initiating (Figure 2A). At this stage, strong expression of OSMADS3 was observed mainly in whorl 3, where the stamen primordia subsequently initiate, and only a weak signal was detected in whorl 4 (Figure 2A). Soon after initiation of the stamen primordia, the OSMADS3 signal disappeared from the developing stamen primordia, but weak expression remained in whorl 4 (Figure 2B). Expression ofOSMADS3 was highly elevated in whorl 4 just before carpel development initiated (Figure 2C), but it disappeared from the carpel primordia after emergence of the carpel bulge (Figure 2D). At this stage, strong expression of OSMADS3 was observed in the floral meristem, which later produces the ovule primordia (Figure 2D), but it was down regulated once the ovule primordia initiated (Figure 2E)[2].
+
Expression of OSMADS3 was first detected at the time when the lemma and palea primordia were just initiating (Figure 2A). At this stage, strong expression of OSMADS3 was observed mainly in whorl 3, where the stamen primordia subsequently initiate, and only a weak signal was detected in whorl 4 (Figure 2A). Soon after initiation of the stamen primordia, the OSMADS3 signal disappeared from the developing stamen primordia, but weak expression remained in whorl 4 (Figure 2B). Expression ofOSMADS3 was highly elevated in whorl 4 just before carpel development initiated (Figure 2C), but it disappeared from the carpel primordia after emergence of the carpel bulge (Figure 2D). At this stage, strong expression of OSMADS3 was observed in the floral meristem, which later produces the ovule primordia (Figure 2D), but it was down regulated once the ovule primordia initiated (Figure 2E)<ref name="ref2" />.
  
 
===Evolution===
 
===Evolution===
OSMADS3 is most closely related to OSMADS58 among the rice MADS box genes. OSMADS3 and OSMADS58 share 96 and 67% sequence identity in the MADS domain and across the whole protein, respectively.OSMADS3 and OSMADS58 share similar genomic organization: they contain 10 exons and 9 introns at the same positions and have a large intron after the second exon, which partly contains the MADS box[2].
+
OSMADS3 is most closely related to OSMADS58 among the rice MADS box genes. OSMADS3 and OSMADS58 share 96 and 67% sequence identity in the MADS domain and across the whole protein, respectively.OSMADS3 and OSMADS58 share similar genomic organization: they contain 10 exons and 9 introns at the same positions and have a large intron after the second exon, which partly contains the MADS box[<ref name="ref2" />.
  
  
 
==Labs working on this gene==
 
==Labs working on this gene==
(1)School of Life Sciences and Biotechnology, Shanghai Jiao Tong University, Shanghai 200240, China
+
*School of Life Sciences and Biotechnology, Shanghai Jiao Tong University, Shanghai 200240, China
  
(2)Bio-X Research Center, Key Laboratory of Genetics and Development and Neuropsychiatric Diseases, Ministry of Education,Shanghai Jiao Tong University, Shanghai 200240, China
+
*Bio-X Research Center, Key Laboratory of Genetics and Development and Neuropsychiatric Diseases, Ministry of Education,Shanghai Jiao Tong University, Shanghai 200240, China
  
(3)Department of Energy Plant Research Laboratory, Michigan State University, East Lansing, Michigan 48824
+
*Department of Energy Plant Research Laboratory, Michigan State University, East Lansing, Michigan 48824
  
(4)Graduate School of Agricultural and Life Sciences, University of Tokyo, Bunkyo-ku, Tokyo 113-8657, Japan
+
*Graduate School of Agricultural and Life Sciences, University of Tokyo, Bunkyo-ku, Tokyo 113-8657, Japan
  
(5)b Division of Molecular and Life Sciences, Pohang University of Science and Technology, Pohang 790-784, Republic of Korea
+
*Division of Molecular and Life Sciences, Pohang University of Science and Technology, Pohang 790-784, Republic of Korea
  
(6) National Institute of Agrobiological Sciences, Kannondai, Tsukuba 305-0856, Japan
+
*National Institute of Agrobiological Sciences, Kannondai, Tsukuba 305-0856, Japan
  
(7) Graduate School of Science, University of Tokyo, Hongo, Tokyo 113-0033, Japan
+
*Graduate School of Science, University of Tokyo, Hongo, Tokyo 113-0033, Japan
  
 
==References==
 
==References==
Please input cited references here.
+
<references>
 +
<ref name="ref1">
 +
Hu L, Liang W, Yin C, et al. Rice MADS3 regulates ROS homeostasis during late anther development[J]. The Plant Cell Online, 2011, 23(2): 515-533.</ref>
 +
<ref name="ref2">
 +
Yamaguchi T, Lee D Y, Miyao A, et al. Functional diversification of the two C-class MADS box genes OSMADS3 and OSMADS58 in Oryza sativa[J]. The Plant Cell Online, 2006, 18(1): 15-28.</ref>
 +
<ref name="ref3">
 +
Li, H.F., Liang, W.Q., Yin, C.S., Zhu, L., and Zhang, D.B. (2011).Genetic interaction of OsMADS3, DROOPING LEAF, and OsMADS13 in specifying rice floral organ identities and meristem determinacy.Plant Physiol. 156: 263–274.</ref>
 +
<ref name="ref4">
 +
Moon, Y.H., Kang, H.G., Jung, J.Y., Jeon, J.S., Sung, S.K., and An, G. (1999). Determination of the motif responsible for interaction between the rice APETALA1/AGAMOUS-LIKE9 family proteins using a yeast two-hybrid system. Plant Physiol. 120: 1193–1204</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==

Revision as of 13:45, 22 May 2014

The rice OsMADS3(Os01g0201700) is a member of MADS-box transcription factors in rice, it belongs to class C genes of the ABC model of flower development in plants[1][2].

Annotated Information

Function

OsMADS3(Os01g0201700)plays key roles in both stamen identity specification and late anther development ,and Loss-of-function mutants of OSMADS3 result severe defects in stamen identity and lodicule number[1][2].MADS3 is highly expressed in the tapetum and microspores during late anther development and is a key transcriptional regulator that functions in rice male reproductive development, at least in part, by modulating ROS levels through MT-1-4b[1].

OsMADS3 plays a synergistic role with OsMADS13 in both ovule development and floral meristem termination[3].OsMADS3 represses the expression of the putative A-class gene DEP (OsMADS15)[3].OSMADS3 and OSMADS58 have been subfunctionalized such that they play more predominant roles in distinct whorls[2].The expression of MADS3 and MADS58 can be activated by MADS6 to regulates the stamen, carpel, and meristem identities at early stages and specifies carpel/ovule development[[4].

Mutation

MADS3 alleles:mads3-1,mads3-2,mads3-3,mads3-4. mads3-1 is a weak allele carrying an insertion in the C-terminal region of the gene and showing no defective floral organs, whereas mads3-2 is an intermediate allele with a mutation at the C terminus of the K-domain and reduced expression of the gene, which resulted in mild transformation of stamens into lodicules[2]. mads3-3 is a strong allele in the Dongjin (a japonica cultivar) background. It contains a T-DNA insertion in the second intron of the gene, which leads to no detectable MADS3 transcript and homeotic transformation of nearly all stamens in whorl 3 into lodicule-like organs [2]. mads3-4, which results in a mutation in the middle region of the K-domain of MADS3, seems to be another intermediate mutant with reduced expression of MADS3 [1].

Expression

Expression of OSMADS3 was first detected at the time when the lemma and palea primordia were just initiating (Figure 2A). At this stage, strong expression of OSMADS3 was observed mainly in whorl 3, where the stamen primordia subsequently initiate, and only a weak signal was detected in whorl 4 (Figure 2A). Soon after initiation of the stamen primordia, the OSMADS3 signal disappeared from the developing stamen primordia, but weak expression remained in whorl 4 (Figure 2B). Expression ofOSMADS3 was highly elevated in whorl 4 just before carpel development initiated (Figure 2C), but it disappeared from the carpel primordia after emergence of the carpel bulge (Figure 2D). At this stage, strong expression of OSMADS3 was observed in the floral meristem, which later produces the ovule primordia (Figure 2D), but it was down regulated once the ovule primordia initiated (Figure 2E)[2].

Evolution

OSMADS3 is most closely related to OSMADS58 among the rice MADS box genes. OSMADS3 and OSMADS58 share 96 and 67% sequence identity in the MADS domain and across the whole protein, respectively.OSMADS3 and OSMADS58 share similar genomic organization: they contain 10 exons and 9 introns at the same positions and have a large intron after the second exon, which partly contains the MADS box[[2].


Labs working on this gene

  • School of Life Sciences and Biotechnology, Shanghai Jiao Tong University, Shanghai 200240, China
  • Bio-X Research Center, Key Laboratory of Genetics and Development and Neuropsychiatric Diseases, Ministry of Education,Shanghai Jiao Tong University, Shanghai 200240, China
  • Department of Energy Plant Research Laboratory, Michigan State University, East Lansing, Michigan 48824
  • Graduate School of Agricultural and Life Sciences, University of Tokyo, Bunkyo-ku, Tokyo 113-8657, Japan
  • Division of Molecular and Life Sciences, Pohang University of Science and Technology, Pohang 790-784, Republic of Korea
  • National Institute of Agrobiological Sciences, Kannondai, Tsukuba 305-0856, Japan
  • Graduate School of Science, University of Tokyo, Hongo, Tokyo 113-0033, Japan

References

  1. 1.0 1.1 1.2 1.3 Hu L, Liang W, Yin C, et al. Rice MADS3 regulates ROS homeostasis during late anther development[J]. The Plant Cell Online, 2011, 23(2): 515-533.
  2. 2.0 2.1 2.2 2.3 2.4 2.5 2.6 Yamaguchi T, Lee D Y, Miyao A, et al. Functional diversification of the two C-class MADS box genes OSMADS3 and OSMADS58 in Oryza sativa[J]. The Plant Cell Online, 2006, 18(1): 15-28.
  3. 3.0 3.1 Li, H.F., Liang, W.Q., Yin, C.S., Zhu, L., and Zhang, D.B. (2011).Genetic interaction of OsMADS3, DROOPING LEAF, and OsMADS13 in specifying rice floral organ identities and meristem determinacy.Plant Physiol. 156: 263–274.
  4. Moon, Y.H., Kang, H.G., Jung, J.Y., Jeon, J.S., Sung, S.K., and An, G. (1999). Determination of the motif responsible for interaction between the rice APETALA1/AGAMOUS-LIKE9 family proteins using a yeast two-hybrid system. Plant Physiol. 120: 1193–1204

Structured Information

Gene Name

Os01g0201700

Description

Similar to MADS box protein

Version

NM_001185293.1 GI:297719720 GeneID:9271572

Length

9393 bp

Definition

Oryza sativa Japonica Group Os01g0201700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:5558512..5567904

Sequence Coding Region

5560361..5560379,5560446..5560507,5561618..5561699,5567047..5567333,5567665..5567679

Expression

GEO Profiles:Os01g0201700

Genome Context

<gbrowseImage1> name=NC_008394:5558512..5567904 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:5558512..5567904 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgatgaacatgatgaccgatctgagctgcgggccatcgtcgatgacggagctgaccgcggcagcggcgccggctgggtcaggatcgtcggcggcggtggcggcggggagcagcgagaagatggggagggggaagatcgagataaagcggatcgagaacacgacgaaccggcaggtgaccttctgcaagcgccgcaatggcctcctgaagaaggcgtacgagctgtccgtcctctgcgacgccgaggttgccctcatcgtcttctccagccgcggccgcctctacgagtacgccaacaacagtgtgaaatccaccgttgagaggtacaagaaggcaaacagtgacacctccaactctggcacagttgcagaagtcaatgcccagcactaccagcaggagtcctccaaactgcgccaacaaatcagtagcttacagaacgcaaacagtctaactcggcttgcctaa</cdnaseq>

Protein Sequence

<aaseq>MMNMMTDLSCGPSSMTELTAAAAPAGSGSSAAVAAGSSEKMGRG KIEIKRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYANNSV KSTVERYKKANSDTSNSGTVAEVNAQHYQQESSKLRQQISSLQNANSLTRLA</aaseq>

Gene Sequence

<dnaseqindica>7526..7544#7398..7459#6206..6287#572..858#226..240#atcagattggaattggccacaaaagctactgctaactacattcacctcacatttcttcttcccctttccctcctcctcctcttcttcctcttcttctcccccacctctctctttaatacctctcctcctcctgttgctgcttctgcctctctcacatcttctttctttccttctctggatctcttccatcttcagaagagagagcactagttagcatacccatccatgatgaacatgatggtaaattctggctttcttgcttttggataaattttgcttcctttcttaacttgagcacaagcttgtgttatatgtggtgtggaatcttggttgccatgttgtgaggatttagctagagagtcaagaaagaggaatatatgctttatgtagataggagtaggatctctgggtctttaaacatcaccatgacaagcaaagataagaacaggagagcagttcttgattattatttttcttctcatcaagaaattaagccggagatagacatggcagctgcacgcagtgattcacttcttgatttcttgatttgggttgttgcgtttgtgtccagaccgatctgagctgcgggccatcgtcgatgacggagctgaccgcggcagcggcgccggctgggtcaggatcgtcggcggcggtggcggcggggagcagcgagaagatggggagggggaagatcgagataaagcggatcgagaacacgacgaaccggcaggtgaccttctgcaagcgccgcaatggcctcctgaagaaggcgtacgagctgtccgtcctctgcgacgccgaggttgccctcatcgtcttctccagccgcggccgcctctacgagtacgccaacaacaggtgattcacaaaatactatctcatctcatcctacttatgcttatataatccataaaattaaccaagaggtctaaaaaggctatggaaatatgcatacacaatagaagctacacatatgtttcttttttttaaaaaaaaagaagaaaatgtttgttggttgagttcatggttgtccaaattggagcaagtatggagatagctttcatgggggcaaagagaggggagggtcaaatgggagatgcatcttttgttacttctgttattaactgtctcgtgttatttggtgtttctggggggaaagaaagaaaatcgcaacagtttctctcttgcttgcttgtgtgtgtgtgctagctagcttcttttgctgctttcctttgtgcttctggtgaggtgagctagatgtttgagatagatctaggacagtgcttgctgtgtgtagtatgctgctgcttcctttctttctctctctctctctctctctctcttgtgtgtgtgagatgagagagagagagagatgttcttctttggcttggtggtcctgctcttttcttgctgtatttatgttttttcctttctctctccactgtggcaagctgtgtgcttgtatgtctgtgtggcagagctagctgtagagatagatgaagagagagagagaggtgagctttaagatctctctcacacctcatgatgtgtatgatcacacacatatttgcacaaaaaatatagagcatcctggggctccattcatcatctttcccttttgtgtagctttgcttgtgtagaagcagatctctagatagcaaggagagtgtgtatggttggccatggcattgatgtactagtagttagtttgtacatgaatgtgccaagtgttagtgtatgtatgtttgatcaggtaataagggtagagggataaacaagcagctgatgatataacactctctctctctcttgtgttccagtttcttttgcatcatctcctgtttccaaccaatgagctgctagggttagggcttcatccccatgtgcatctctctctctctctctcatgagtgtgtgtggctgtgtggtgcaaattttagtcccgagcaacttcacgagggcaggtgatgcctgacagcaccactgtacttttgaacaggaaccaaacacaaagaagggatccaacaaagaaacagcagtaaagatgaaaaaaatacagtaaagtatataggggagtacatatgcatgcgtttgatttactgaaagaatttacacaaagatgattgttccatattttttgcatgtctccctttcctcataagctatacatactgaataatgtgattatataaaaatattagctagtctttttttacaaatgattttgttatgactattagttctagttatgtgtcgtatgcatgtaaataaaaaagtggcaggataagcttatttgttttttcatcaaataaagaaaactaaaatttgtgtaccaaaatatcagtttcaatgttatgtgaaaacatgtcatgcaggcataaaaaaaattacacacatggccactgttgtctagttatgttgaagaaaaaactgaaaaactgtggtctgcatgaagtatttgaaatcaattaataaaacatattgactttttcttttttgcttcgcgactaatcaatcctccttgaaaaacgaaattagaagcacatatatacgttttgttgcactgcttaaacatggggatcagaaacctctcatgtatcctcaccaaaaaaaaaaaaagagaaagaaaaagaagcctctcttgtacggatgacacgtgtccatgcagccactgtcgcagtagaaatggcgtccaatggcgtggcagcaatggtacaactactgggcctgcatttgtattgggagactacaagaggagtgaagaaaagctggtggctttggtcagaatgggaatgggtaaaagcctacagttgtgtagtgtagtctctgtgtgtgcgttgctgccttgttgccctcgtttgtccattgggttaaaaccagtctcactgttgctgcccaatcatgtgaaatcctgtgcccagcttcacattgggcagccaaatagcgttctcgagaatcctaaggtttcatttctttcttgccaggaagatagtaggattgatgtctgtacttcagtactaccattactccaatttctttggtcctcgaacaatatgtttactggtacattaccactgtaatgtgacatcttttttgcatttttttagataatggacatcttttttgctacccaaaatataagaaattctaaggaatgacagaaagtaggtgaaataaaataggaaataattgtggtaggttgatattgaggagcaggtgaaaaaagtttttatatttaggatggagggattaagtaatttcttgcctgaaaatcttcatttgggttggaggggattgatagtgctcgctgcttgatatgattgtttgttagttattttatgcagcaattgcacgctttatgtttggacaaaggaaaatttcaaaggttgtagtgaaaagacatgagctagctagcagtcacttcacagtagcatgcatgaacagaagatctttgaagaatatttttggagaaccttttggggatatctttggtatacagtgatctctagctaggttttttttagggtagtactccgtatactatttccacatatttgtcggtccttggaaattaaaatgatttattctcatggatttatcatcataagcagtttctgctcaagtattgtcagcagtttgtgttattgacttgtttggtagttttttttttttttgaagaacttatttgctagttggctgactaggtagcaagtacaccattttggaaggtggccttccacaattttctgtctaaatatgcttaattatatggacataacaatatctcctttgtgacaataaaaactgtggaactacgtagttccacgtatacgttacgtggttacattagtaagtacaaccttgtaaaacattagcatgtcatatgcattgatctgcctaagaaacgagaataaaatctctgcgatgagaagtactgttggagagtttatagattgcttaaggtaataggatattttttgttttcttgttatatactattcatcgtaagctctgctcctattgccgcatgccctgttttcttcaagctattcaagctagatatgatgctttgcttgataactatgcaagaaaaaacaagatttataaggtcaaaataagtttgcttcctacatgcttgggtttttcatatgttaaggttgaaaatcataattaacaaacacaccaaaactaaaatagaatacataatgtgatcgtgaggtgaacacgggataagtgttgtttgggctgtcaaacgtacgttctatacaactgaactccaaatatatattatcatccataccatcatttttgagttttcttatttttcaaaaaagagaaaatactagtgtatccccagtccatagtatatctaagccttgatttttttaccttttatttatagtattattagagttcacttaagaacttagctctggtactactcatttttttatactaaatttatgaatgcactttgtaagtcatcacatatttgtacatctaattgtttagcaatgtgcacaaaattaactatttgttatctagttaaggtgtatattaatatgattccgtgatttcgttaacttgtactgaaaacggagtagcatgttagggccactattctatagctttatctgttaattcgaacctgcaatttcagaagtgtctttatatcggtttcaaagagtgataaagcgcacatacactgatccttagtccattatatgtagtcttgtatgctctttttcggatgaaaatagttttatacgcttggtgccattattctcttgacatagtgtctcaaaattttgtaacttaatgctgatctttagttcattatatgtagtcttatatgctctttttcggatgaaaatagttttatacgcttgctaccattattctctcttgacgtagtctctcaaaattccgaacttcacagtctcagtttgcatactttttgttttctcttctttgatttagggagccttgagttattttcgttgaatagtacgtattactagtatataagaagcacatagcagcgacttttgatttgcagtcattttataatatgaaaaataccccacaaaaaataatatgaaaaatagaataagtgaaactagtaataatcggcaagtgctaactaatggggataaatataactcatgaaatattgccaaataagatgatgtctgaatacactggagtcgcacaattgtttttttccttgtctggtggcgtcagctagcgtttgtgttcacttgtcccttcgacacaccggtatatcacgatttcttgtgccgtacccaaaaacaaaatcatggataagaaacacacatcacaccaatggagtcgtctagtctcattttgtgcatcaaaacccccagatcgatgacaggaaaagctctctatctcctcggtaaagagaaacagtactccactgtgctactctgcagtagttcatgaatgagcgagtgacttgtgatagcgcacgattcggaccaatgtgctatgttgtgttttaactatggtcatttgcccttgaacgccacattctaaatgtgaagtattccctcctgttcatatgataaatcgtttgatttttttttctaatcaaacttctttaagtttattaaattatagaaaaatatattagtatgttcaacataaaacaaaaatattatcaaaataattaatgtttaatttaatgaaactaatttgatattttagatgttaaatttttttataaacttgatcaaactaacaaagtttgactagaaaagaaaatcaaatgacttataatatgaaatggagggaatactagatattaatgtcagtttcaactttctactgcacttatttatactgtattctctgtattactaattgatgttggttattttcgtccttttagtagtacatgaagatgctgacaagctatgctcagttgcctcttgtgtaaacttttaaaaccaatacttatacgataatttcgggatagtaaattcaattaattatcatacttttctccctcatagctagcttgccgaaaattatatgttctagaaaaaaaaacttttttggaattgcctagcgagtaagttttttttttcgcagtcgtcttggctatactgttctgaaactggtaatttcttgtgtaggagtgattaaacataacccttgactaatcatggtcatattgcagtgtgaaatccaccgttgagaggtacaagaaggcaaacagtgacacctccaactctggcacagttgcagaagtcaatgcccaggtaacatcatgtcatttctttcagtctacattcttcaactagtactaaattttccgaattgactccgagatgtggacatatatagatatcagaataacagtaagagcaatctttaaatgctatagaactttcaacattcttactagttactgttgtgcaaacgcaaacatgcatgacctctctgagcaaaatcttcagacaagaaatcctgagcagaaagttatgggcattacacagcggttattgcagccaaccaatgctctgaggagtcaggatcctctgtatgatccagtggatcacatgcaattgttcattagaccaatatcgtaatttcatggcggtagagatgcctaggggttcacaaatcttagacaaacattgaaaatttgtggattaatgtagagaacaattaaaaccatcaattgtttatgcttagtcatgtccaccagccatgaattaatcttgcaatttatgagtatcataaaccagctagtagtcaaaaactgcagtatgtatccccttgaaggcttgaacagaactatttggtgtgctcagtatattataggttgaaggaaactataggggtgtgaagtagtatttctaataagaattaatttcctggcaccacatgaaatattactccataaacaaatgtactacgtaagtagttagtagtagtaaaaacagactatctgaatttatacactaactccatcctatttcttaacttatataacttaatttgatgattctatcccagcacagtaagctactatagtatgaaccttcagactgcactgatgtttttctgctagagtggtgtattgcatacagtagatttttattgaaaaaaaaacttggcctgtaaaatttcttatagctaaatctgagagatcatgtagttttttgtgaagaatatgacgtacgtaacataaaacttttaaacaaagacatgtttaatacataagtgaaaattgaaatagactaattataacccaaacaggagtttttctctgcgaatgttcggttgaacatcatttcagctagaatatgttttcaacataaactttatgtactgatgaatgctatcatatatgctgcaaactgcagcactaccagcaggagtcctccaaactgcgccaacaaatcagtagcttacagaacgcaaacaggtaaagattccagatacgtatgacttacttttgcaccaatataaaccaaaatgttctgtattgcagtctaactcggcttgcctaaatatctctagtaggaccatagtgggggattctatcaacaccatgagcctcagggaccttaaacaggtagagaacaggctggagaaaggcatagctaagataagggctagaaaggtatatagtgcaactcaatttaaagcattatataacttatagtatacatcagctatttcttcatgacttttgactaagtgcaaattctatgttctttaattccatgcatgagctatcgatgtcctttgtatatctcaatttcattttgatcgtcctaatcaacccagtggacatttctttatcgcagaatgagctgttatatgctgaagttgagtacatgcagaaaagggtaagtaagatcatagcacgagaactcgttttatgccaaccgtacgtagtttcctttcttttgcatgtcttagttccatttttcagaccaaattacatgtcacatatatattattcttcaggaagttgagctgcagaatgacaacatgtacctgaggagcaaggtaaatacattcctatgaggataagttattgcagttccaatatagttaattaccaactgaattctttctgagagctgtggcctctgattatataaataattgattatgtaggttgttgagaatgagaggggacagcagccactgaacatgatgggggcagcatcaacaagtgaatacgatcatatggttaataacccatatgattccaggaactttcttcaagtgaacatcatgcagcagcctcagcattacgcccatcagctgcagccaactacccttcaactcgggtaaattgagatcaattaactgaatatatatgcttacagaatttcatgctccagagatcgagattatattattcagtctttttgtgtttcttacaaatccagctacatatgttaatatacagttcttgtttaacttttgtttctattctgcaggcagcagccggccttcaattagttttggtgtagacaccgtacgtacacacgtacgttaggtaaataaaacactcagtactgtagatttatacctacacaaaagtatatatttgcagagtataatccagttaggcaagttgatatttaccctctgctatttttacataactgccagcggatactatttactttcgaactttggcaactcgtctttggaaatgataaaatgttattaaagtgtgctatatcttaaatacaagcatcggacttttgttcactttggtctaacaatttgagagaaaacaatgttcaatattcaaatggaaagtaaatgttgtcagttatttagaaacgaagggagtatatgtattactggcattcatcttaataattaactcagtaactgtttcttacatctcttgtagttgaaatctgaaagtgtgttgtatctgttgcagatgaaatctgaaggcgtcgatacccgcggctacgtaacagcgtgatcaacctgaagaaatcgatgcagtaattctatgtgttcgtcagatcatcataaccagtattgtcattaggcgttgtgaaaaaaaaatgtgtcagcatgcattgcaagctagcgtttgtggctgctcatcagctgcatgcgtaattgcgtacgtgcacaaattaaacagaccttgccaccattgtgccatattgtgtgtgttgtatgatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatataaacagcacgtttgtgctctgattcgtgtaactgatcagcagatcaaactctaccactgccgatatatatgtgaggaccatggattgatgcattgtcgttgatcttc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0201700, RefSeq:Os01g0201700