Difference between revisions of "Os07g0108900"

From RiceWiki
Jump to: navigation, search
(Mutation)
(Expression)
Line 6: Line 6:
  
 
===Expression===
 
===Expression===
'''''OsMADS15''''' was previously isolated through a large-scale cDNA analysis conducted by the Rice GenomeResearch Program (RGP). It is expressed in the apical region of the floral meristem at an early stage of spikelet development, and also expressed in developing lemma, palea and lodicules<ref name="ref2" />. '''''OsMADS15'''''are expressed in the incipient floral primordium<ref name="ref3" />. Transcripts of '''''OsMADS1''''' and '''''OsMADS15''''' are eventually accumulated in lemma and palea, suggesting that '''''OsMADS1''''' and '''''OsMADS15''''' might also be involved in the development of lemma and palea<ref name="ref4" />. Rice seedlings overexpressing '''''OsMADS15''''' showed precocious phenotypes of early internode elongation, shoot-borne crown root development, reduced plant height and early flowering.
+
'''''OsMADS15''''' was previously isolated through a large-scale cDNA analysis conducted by the Rice GenomeResearch Program (RGP). It is expressed in the apical region of the floral meristem at an early stage of spikelet development, and also expressed in developing lemma, palea and lodicules<ref name="ref2" />. '''''OsMADS15'''''are expressed in the incipient floral primordium<ref name="ref3" />. Transcripts of '''''OsMADS1''''' and '''''OsMADS15''''' are eventually accumulated in lemma and palea, suggesting that '''''OsMADS1''''' and '''''OsMADS15''''' might also be involved in the development of lemma and palea<ref name="ref4" />. Rice seedlings overexpressing '''''OsMADS15''''' showed precocious phenotypes of early internode elongation, shoot-borne crown root development, reduced plant height and early flowering, and Affected Panicle Development and Produced Ectopic Crown Root Growth.
 +
1.Overexpression of '''''OsMADS15''''' Decreased Tiller Number(Fig. 1).
 +
[[File:pictures.jpg]]
 +
2.Overexpression of '''''OsMADS15''''' Accelerated Flowering(Fig. 2).
 +
 
 
RT-PCR with the following primers:  
 
RT-PCR with the following primers:  
 
OsMADS15-F, 5- TCCGTCGACATGGGGCGGGGGAAGGTG-3;  
 
OsMADS15-F, 5- TCCGTCGACATGGGGCGGGGGAAGGTG-3;  
 
OsMADS15-R, 5- AATGGTACCTTAAGCATTGAGGTGGCTC-3<ref name="ref1" />.
 
OsMADS15-R, 5- AATGGTACCTTAAGCATTGAGGTGGCTC-3<ref name="ref1" />.
[[File:pictures.jpg]]
 
  
 
== Mutation ==
 
== Mutation ==

Revision as of 16:47, 22 May 2014

Please input one-sentence summary here.

Annotated Information

Function

The rice Os07g0108900 gene is reported as MADS-box transcription factor 15(OsMADS15). Rice OsMADS15 is a member of APETALA1/SQUAMOSA(AP1/SQUA) subfamily, which plays important roles in biological processes such as flowering time regulation, adventitious roots development, stem growth, reproductive development, crown root development and palea development[1]. The OsMADS15 is the ortholog of Arabidopsis AP1 gene. OsMADS15 function in tetramer complexes with OsMADS1, OsMADS8 and OsMADS14, as described in floral quartet model[1]. Rice seedlings overexpressing OsMADS15 showed precocious phenotypes of early internode elongation, shoot-borne crown root development, reduced plant height and early flowering. OsMADS15 interacts with OsMADS1 in yeast two-hybrid experiments[2].

Expression

OsMADS15 was previously isolated through a large-scale cDNA analysis conducted by the Rice GenomeResearch Program (RGP). It is expressed in the apical region of the floral meristem at an early stage of spikelet development, and also expressed in developing lemma, palea and lodicules[2]. OsMADS15are expressed in the incipient floral primordium[3]. Transcripts of OsMADS1 and OsMADS15 are eventually accumulated in lemma and palea, suggesting that OsMADS1 and OsMADS15 might also be involved in the development of lemma and palea[4]. Rice seedlings overexpressing OsMADS15 showed precocious phenotypes of early internode elongation, shoot-borne crown root development, reduced plant height and early flowering, and Affected Panicle Development and Produced Ectopic Crown Root Growth. 1.Overexpression of OsMADS15 Decreased Tiller Number(Fig. 1). Pictures.jpg 2.Overexpression of OsMADS15 Accelerated Flowering(Fig. 2).

RT-PCR with the following primers: OsMADS15-F, 5- TCCGTCGACATGGGGCGGGGGAAGGTG-3; OsMADS15-R, 5- AATGGTACCTTAAGCATTGAGGTGGCTC-3[5].

Mutation

Single amino acid mutation disrupted the transcriptional activation of OsMADS15 in DEP mutant and caused shrunken paleas.DEP mutant was caused by a genetic alteration in OsMADS15. A single nucleotide G to C substitution at position 94 in coding region was found in the first exon of the OsMADS15. This substitution results in a change from a MADS-box conserved alanine residue to proline. Mutations of them lead to the switch of reproductive habit from sexual to asexual in rice. Paleas in severe DEP florets degenerated to glume-like organs that were prone to splitting. The premier used in this mutation experiment[6]: Premier in dep.jpg

Labs working on this gene

Please input related labs here.

References

[1] Lu, S.J., Wei, H., Wang, Y., Wang, H.M., Yang, R.F., Zhang, X.B. and Tu, J.M., 2012. Overexpression of a Transcription Factor OsMADS15 Modifies Plant Architecture and Flowering Time in Rice (Oryza sativa L.), Plant Molecular Biology Reporter. 30, 1461-1469. [2] Lim, J., Moon, Y.H., An, G. and Jang, S.K., 2000. Two rice MADS domain proteins interact with OsMADS1, Plant Mol Biol. 44, 513-27. [3] Kyozuka, J., Kobayashi, T., Morita, M. and Shimamoto, K., 2000. Spatially and temporally regulated expression of rice MADS box genes with similarity to Arabidopsis class A, B and C genes, Plant Cell Physiol. 41, 710-8. [4] Prasad, K., Sriram, P., Kumar, C.S., Kushalappa, K. and Vijayraghavan, U., 2001. Ectopic expression of rice OsMADS1 reveals a role in specifying the lemma and palea, grass floral organs analogous to sepals, Dev Genes Evol. 211, 281-90. [5] Wang, K., Tang, D., Hong, L., Xu, W., Huang, J., Li, M., Gu, M., Xue, Y. and Cheng, Z., 2010. DEP and AFO regulate reproductive habit in rice, PLoS Genet. 6, e1000818.

Structured Information

Gene Name

Os07g0108900

Description

MADS15 protein

Version

NM_001065255.1 GI:115470242 GeneID:4342214

Length

6425 bp

Definition

Oryza sativa Japonica Group Os07g0108900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:470174..476598

Sequence Coding Region

470595..470721,470877..471040,471552..471593,471730..471771,472147..472246
,472396..472460,473795..473873,476290..476474

Expression

GEO Profiles:Os07g0108900

Genome Context

<gbrowseImage1> name=NC_008400:470174..476598 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:470174..476598 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggggcgggggaaggtgcagctgaagcggatagagaacaagatcaacaggcaggtgacgttctccaagaggaggaatggattgctgaagaaggcgcacgagatctccgtcctctgcgacgccgaggtcgccgccatcgtcttctcccccaagggcaagctctacgagtacgccactgactccaggatggacaaaatccttgaacgttatgagcgctattcatatgctgaaaaggctcttatttcagctgaatccgagagtgagggaaattggtgccatgaatacaggaaacttaaggcaaagattgagaccatacaaaaatgtcacaaacacctcatgggagaggatctagaatccctgaatctcaaagaactccaacagctagagcagcagctggagagttcattgaagcacataatatcaagaaagagccaccttatgcttgagtccatttccgagctgcagaaaaaggagaggtcactgcaggaggagaacaaggctctgcagaaggaactggtggagaggcagaagaatgtgaggggccagcagcaagtagggcagtgggaccaaacccaggtccaggcccaggcccaagcccaaccccaagcccagacaagctcctcctcctcctccatgctgagggatcagcaggcacttcttccaccacaaaatatctgctacccgccggtgatgatgggcgagagaaatgatgcggcggcggcggcggcggtggcggcgcagggccaggtgcaactccgcatcggaggtcttccgccatggatgctgagccacctcaatgcttaa</cdnaseq>

Protein Sequence

<aaseq>MGRGKVQLKRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVA AIVFSPKGKLYEYATDSRMDKILERYERYSYAEKALISAESESEGNWCHEYRKLKAKI ETIQKCHKHLMGEDLESLNLKELQQLEQQLESSLKHIISRKSHLMLESISELQKKERS LQEENKALQKELVERQKNVRGQQQVGQWDQTQVQAQAQAQPQAQTSSSSSSMLRDQQA LLPPQNICYPPVMMGERNDAAAAAAVAAQGQVQLRIGGLPPWMLSHLNA</aaseq>

Gene Sequence

<dnaseqindica>5878..6004#5559..5722#5006..5047#4828..4869#4353..4452#4139..4203#2726..2804#125..309#ctcctcctcctcttcttcttcttccactagctagttcgtcttcctccttcagctagcttgtagcagctaaggttaggtcggatcgagatcgggatcggccgccggcgagcggcgagcggcgaggatggggcgggggaaggtgcagctgaagcggatagagaacaagatcaacaggcaggtgacgttctccaagaggaggaatggattgctgaagaaggcgcacgagatctccgtcctctgcgacgccgaggtcgccgccatcgtcttctcccccaagggcaagctctacgagtacgccactgactccaggtacacctatagcctgatcgattccttgccatttctggagcacctgagcccgcctgagatggatgaactcaataattctcctagctttttgccgtttctggccggccgcttccatggatttcagctgctgctctctgaatttgccatgtttggtttgtgcatctggttgcatgtgtgctacagctgatgattttatgcttcactagtgctgcaacacatgcaacacagtccaatccaagctagctcagctactccaggaggaggagtcagctgcatgcctcctcatttcgggaaatcatctctctctctttctattttttccctttcctttcttgtttcccctttttctttcctgctagcttgcttctctctctacaccctgcataccctttttgggattgatggccggttttaattaatttcccctcctttctttagttaattactaccctactactaattcatctcctcccgatcctctcaatttctcatcatatggagtactactaaaatatatatatgtagtacgcacttggtgtggccggtctttgttaacatcatgtgcttgcttagattcaaggggattatatatataagaggatctactactaagtgtactttgtgattacatcagctatctatgtagctgatgatcttgctttggtcttttgctgatccattgagctagtgctaattctcatcacccttccatttgatgtactgcaaatagttttttattcattcgcttcttctccctcttccccatgtgatttgattgctagctccttcctgacttttatttgggttgatttcgtcacatcttcctctcaaattaatctcatgcgcgtgcctttgttctccacctgtcaagaaattaattaaagaatatatcacacgaattacgaggagtccaccaccagtgtcatgcactcctccctattgttcacagtcacagctgatgcatgcaaaacatcttctgtttctcaagtaattaattcccctcttcttgtgaggcttggcttaaaattactcaaacagctgtttttcttgcttatgcatcatcttcctcagataccaaaacgttggagatggacagatctggcctttcctcttcccttctctctcatcctcttctatgtttctgcctcttcttatgatgaatctttatttggtattattcacgttaagcatctctttaaagagccctagatcaaatttgatctatctcttttggtttaacttcatggccagttgcttgtgtgttttggtctagaacgaccacgtacgcgagatatttccttttctgctcagctgattaattaataatgatgggataattcactaattattctggagttagatcaagagatgtacttaaacatcctgtgacacgatgacttcaaaaaataatcttgctctctgtaaaatcacataatagctagccatcgcgcgtgtttcagaaaaataatttatcttgcttgctagcttttgctcaaaatgcgtttctgacgtctaggtaaagaggacttttacggtcgtctgtgttgtactggaacagtgccctgcacactccccagcgtcaagatcagtctaaggcgcttcatttctagctcagaaatcttcacttatttgatcttaattatagatcttcctgagatagatctaagggtgttccagtaaaacagaagaagtcaagttcttcaggatcctcgtgatataattaaactgtagtctcacaatcttactgatcatcaaggagtctgtaaacacctatacgtacggctataggattatggggaggttggtctaaaataaaggtgttaaattacttgcaattatcaagatgtgcaaatcatcacccagtaattcaatggtgctattatatatagtctgttttgaacagttccactggttttgttagggtccttgctgatggctgtttaacggtgctgttatatataatcttgattattttttttgctaaattttcctaagcaacccacttcaaattttggaatgggtgaattcttatgttcacaccctcatatcacatgtgtcatgaggagcttttttttcgtcacacagtcccatacaacgtccctgttttcttgaagataagataattcatgcatgcacttgaatataaccgagtgttttcatgtgcatgctttttatttggctgtgtcgagtgtttagacagcaaaagagctcttgtgcatacaaatgccgatatctatatattagtagtcttaatccacatttcagctttaattgcttggaatagtttggtaggcattcctagcttcagaccatttaaatatacttcctaaacgttgtcatgagaatgctgaatgcaaagtatttacatatatagtggactaatttcagattctgctcatgatggttttccctgcaggatggacaaaatccttgaacgttatgagcgctattcatatgctgaaaaggctcttatttcagctgaatccgagagtgaggtaaaacacagtaggttgtatgatatataacttttacatgaagggaatattattgttccttttctattgcattagcatttcaatcatatcatttccttgtggccttttaaatcacatgttaacaaagcagtttttctgaattctatcgttctacttgccaaaactagatgttggtaaccttctgttttatactttttaacttcaaacctcgtgtcttttgcactctggcatatttcttaaaatttctacttattgggatatcatgcaggagagtcctcattcccttcatttaatcccctcaaattttatttattatggtcatacaattaatgggccacatgcatggaagtcgatcgccagcttgcgatcagcatcctatcattaatgttatgatctatactaattcttctgtaaataaattaaaattgcactagtttttaactaaatgctactattctatttttttatccatactccgtttgagtggtttcttttgtgtttcatgaagcaatataatatgcttaagaaaacatagaaacatgcacaatacaataatagcgctggtagaatccggttggagaccaaatgtttcgatattctaagtgcatatttatatatactaagtaaaactgtaatcataaacatgcatatggactgtgatcgatgaaatgtttcttcattttttttttcaagataactcttccccagttgacaacatgcactgcatccagaagtactcatggtatttgttttcagtactgtttgatgagtaaaactttggtaagtgttaaaaaatgatgataagtgcaaatatttgttcctttaccacttccaccttcttggagtaaagaaaaaaatgtgtgtggtttggcaaagttgttgcatatatcacggcattagtgtgcggataatgcgaataaatgcatcaataagcactaggagtaagttaattagttctctaccttaattgaaaagttcatgtacatttaaaaaaattaaacatgcctctttttatcatttgttgaatttctacatttatcaagacagcaaaggagttctcatctactaataaattaatttaaggagctataactcccttaattttatcaaatattcacatacacggttgcatttgaggattttctatatactccactaaatgaggatgcatttaggttctttataatattttatttccatcgtttcatcatctgtttatgtttacagtaatttagtaatagttctctaattttgacagtaatggttggctcacagaaaacatcaaccaaccatatatattggtttatactgacaaagagtttttttttgtacagggaaattggtgccatgaatacaggaaacttaaggcaaagattgagaccatacaaaaatgtcacaagtaatcgatatatatatccaatttctataataatgttaaataaatttcgaactaattgcactaattattatttttaaaccaatttaaaagagaacttccggtattgactgctgaagatgacgtgaaactaacttatgtatcttgtgtagacacctcatgggagaggatctagaatccctgaatctcaaagaactccaacagctagagcagcagctggagagttcattgaagcacataatatcaagaaaggtagtatttttttggatagtggaatctttttatttgaactcccgacctctacacaccaaatgtacagaaaaaaaggagcaaattattaaaagaaacgtagtaatatatttagcatgttctgtttcaaactggactgaattgaaataattcatgcatgcgcatgcctgagttacataaatatatatccaaatgtcttgttgtcactgctactttgaaacaaatgttcttttttttttcctttttgagaaaatatatgagtaaatattttcagcacattctggaggaacaattaccaaatataaactttttagcacattctggagtacaattaccaaatatgacggactaactagaacaatatgtttgtgtttgcagagccaccttatgcttgagtccatttccgagctgcagaaaaaggtgaccaattgaactgcactactgtgtatgcatgtatatatgaatcgtgcatgcaaaccgttgttagctagtagttagttatagtttactcttggttagtctcaactgatagtgcagttttcttgcatgagtgcaggagaggtcactgcaggaggagaacaaggctctgcagaaggaagtaagttgtcgaaaatatagtatttactgctgcttatattaattaattcattctgcttgactagccaatggaggcactaaacataattaattcatgcgcattggttttgatcaattgatttatcttgttgacaattttccaatctatccatgggtttaattactagttttgtcaatggaggcattagagataattaattcatatgcgcactcgaaagtttgaaattgctgtagtttacttgttgggtggatcatatcgccaataattttttcccccacagttgaccgcaaatgagaagtaattttctttgccttctagacttgacggctatttttttagcgtgttggcaattgaacatatgaccttgggttaaaaccacacatcttttatcattgcgctatcaaatacatctcgataaatttgtcccttactagcggtttatgtggtttccttggtggtcggtttgtgcctcttagaaaaaaatcgtgatgtttgtagtgtgcgcatgcagctggtggagaggcagaagaatgtgaggggccagcagcaagtagggcagtgggaccaaacccaggtccaggcccaggcccaagcccaaccccaagcccagacaagctcctcctcctcctccatgctgagggatcagcaggcacttcttccaccacaaaatatctggtacgtatatgtctgcattcatgtctcatcagttgctattcagttataaattaatctgttactgcactaattaagatcgatcacacccttgttaagttctaagtctctaattaattaactgcatgtatataattatgcacatctgtgcatagtagctacccgccggtgatgatgggcgagagaaatgatgcggcggcggcggcggcggtggcggcgcagggccaggtgcaactccgcatcggaggtcttccgccatggatgctgagccacctcaatgcttaagatgatcatcgtcgtcgtcgtcggccaaacagctgccgtatgcaccgtgaatcatgggagcaaccttgaatgaattgaagtcattggtatcgatcctagcgataatatatatgattctcctaaaatgaaattgatctcaaaaaaacaaacctagcgattaagctattcttatatatgtgtttgcctgctgccccctaccctacaggctacatatgatttgcaagaaattaattatgagcaaggatcaggatgtgtctttgtgtaatcatcagcacgtacctagtgcttcctactgatatatatgcatgcaattgtgtgcatataaatatatttgcatgccatgctcccgtgatggttaattaatttatgattgtgtttatacgctaattaactgcagatgcaaactaatcaatcgaattat</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0108900, RefSeq:Os07g0108900

  1. 1.0 1.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref6
  2. 2.0 2.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. Cite error: Invalid <ref> tag; no text was provided for refs named ref4
  5. Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  6. Cite error: Invalid <ref> tag; no text was provided for refs named ref5