Difference between revisions of "Os11g0639100"
(→Function) |
(→References) |
||
| Line 20: | Line 20: | ||
<references> | <references> | ||
* <ref name="ref1">Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.</ref> | * <ref name="ref1">Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.</ref> | ||
| − | * <ref name="ref2"></ref> | + | * <ref name="ref2">Sana TR, Fischer S, Wholgemuth G, Kalrekar A, Jung K, Ronald PC, Fiehn O. 2010. Metabolomic and transcriptomic analysis of the rice response to the bacterial blight pathogen Xanthomonas oryzae pv. oryzae. Metabolomics 6, 451–465. </ref> |
* <ref name="ref3"></ref> | * <ref name="ref3"></ref> | ||
* <ref name="ref4"></ref> | * <ref name="ref4"></ref> | ||
Revision as of 04:25, 23 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
This gene(Pikh; Pi54; Pi54rh) confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae.
Function
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US [1].The co-expression patterns of bacterial disease resistance genes and their transcriptional regulators in transgenic rice have indicated that the resistance genes trigger an immune response [2].
Expression
editing
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
<references>
Structured Information
| Gene Name |
Os11g0639100 |
|---|---|
| Description |
Conserved hypothetical protein |
| Version |
NM_001189745.1 GI:297728620 GeneID:9272143 |
| Length |
1021 bp |
| Definition |
Oryza sativa Japonica Group Os11g0639100, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 11:27105883..27106903 |
| Sequence Coding Region |
27105883..27106477,27106689..27106903 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008404:27105883..27106903 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008404:27105883..27106903 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq> |
| Protein Sequence |
<aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq> |
| Gene Sequence |
<dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica> |
| External Link(s) |
- ↑ 1.0 1.1 Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.
- ↑ 2.0 2.1 Sana TR, Fischer S, Wholgemuth G, Kalrekar A, Jung K, Ronald PC, Fiehn O. 2010. Metabolomic and transcriptomic analysis of the rice response to the bacterial blight pathogen Xanthomonas oryzae pv. oryzae. Metabolomics 6, 451–465.
- ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref3 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref4 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref5 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref6 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref7
