Difference between revisions of "Os03g0111300"
(→Annotated Information) |
|||
| Line 1: | Line 1: | ||
Please input one-sentence summary here. | Please input one-sentence summary here. | ||
| − | ==Annotated | + | ==Annotated Informatio |
===Function=== | ===Function=== | ||
Please input function information here. | Please input function information here. | ||
Revision as of 12:56, 23 May 2014
Please input one-sentence summary here.
==Annotated Informatio
Contents
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os03g0111300 |
|---|---|
| Description |
Nonspecific lipid-transfer protein 2 (nsLTP2) (7 kDa lipid transfer protein) |
| Version |
NM_001055258.1 GI:115450244 GeneID:4331362 |
| Length |
476 bp |
| Definition |
Oryza sativa Japonica Group Os03g0111300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 3:630670..631145 |
| Sequence Coding Region |
630809..631099 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008396:630670..631145 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008396:630670..631145 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgatgaggaagttggcggtgttggtgttggcggtggcgatggtggcggcgtgcggcggcggcgtcgtgggtgtagcgggggccggttgcaacgctgggcagctgacggtgtgcacgggggcgatcgcgggcggggcgcggccgacggcggcgtgctgctccagcctgcgggcgcagcagggctgcttctgccagttcgccaaggacccgcgctacgggcgctacgtcaacagccccaacgcccgcaaggccgtctcctcctgcggcatcgccctccccacctgccactga</cdnaseq> |
| Protein Sequence |
<aaseq>MMRKLAVLVLAVAMVAACGGGVVGVAGAGCNAGQLTVCTGAIAG GARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH</aaseq> |
| Gene Sequence |
<dnaseqindica>47..337#gtacctcgcagcaccaagctagctagcttcgatcagtagctggaggatgatgaggaagttggcggtgttggtgttggcggtggcgatggtggcggcgtgcggcggcggcgtcgtgggtgtagcgggggccggttgcaacgctgggcagctgacggtgtgcacgggggcgatcgcgggcggggcgcggccgacggcggcgtgctgctccagcctgcgggcgcagcagggctgcttctgccagttcgccaaggacccgcgctacgggcgctacgtcaacagccccaacgcccgcaaggccgtctcctcctgcggcatcgccctccccacctgccactgatccatccatccatcgtctcctactcttttattttgtgatgtggtgtacgtgttcgtagtattgtcttggcgtcatctcgtcacgacgcgtatatgcatgcgcagtgcggcttttgaataaaaggggatcgaccgatgtt</dnaseqindica> |
| External Link(s) |