Difference between revisions of "Os03g0111300"
(→References) |
(→Labs working on this gene) |
||
| Line 19: | Line 19: | ||
Structure, biological and technological functions of lipid transfer proteins and indolines, the major lipid binding proteins from cereal kernels | Structure, biological and technological functions of lipid transfer proteins and indolines, the major lipid binding proteins from cereal kernels | ||
J. Cereal Sci., 32 (2000), pp. 1–20 | J. Cereal Sci., 32 (2000), pp. 1–20 | ||
| + | |||
[2]J.C Kader | [2]J.C Kader | ||
Lipid transfer proteins in plants | Lipid transfer proteins in plants | ||
Annu. Rev. Plant Physiol. Plant Mol. Biol., 47 (1996), pp. 627–654 | Annu. Rev. Plant Physiol. Plant Mol. Biol., 47 (1996), pp. 627–654 | ||
| + | |||
[3]K.L Larsen, J.R Winther | [3]K.L Larsen, J.R Winther | ||
Surprisingly high stability of barley lipid transfer protein, LTP1, towards denaturant, heat, and proteases | Surprisingly high stability of barley lipid transfer protein, LTP1, towards denaturant, heat, and proteases | ||
FEBS Lett., 488 (2001), pp. 145–148 | FEBS Lett., 488 (2001), pp. 145–148 | ||
| + | |||
[4]J.P Douliez, C Pato, H Rabesona, D Molle, D Marion | [4]J.P Douliez, C Pato, H Rabesona, D Molle, D Marion | ||
Disulfide bond assignment, lipid transfer activity and secondary structure of a 7-kDa plant lipid transfer protein, LTP2 | Disulfide bond assignment, lipid transfer activity and secondary structure of a 7-kDa plant lipid transfer protein, LTP2 | ||
Revision as of 13:02, 23 May 2014
Please input one-sentence summary here.
==Annotated Informatio
NsLTPs bind to a variety of lipid molecules and catalyze their transfer across membranes in vitro [2]. NsLTPs also have additional biological functions, including biosynthesis of cutin, involvement in defense against pathogens, and managing abiotic stress conditions imparted by temperature or drought [2] and [3]. The nsLTP superfamily possesses eight highly conserved cysteine residues forming four disulfide bonds [1] and [4]. NsLTPs are subdivided into two subfamilies that differ in molecular mass, nsLTP1 (9 kDa), and nsLTP2 (7 kDa) [1].
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
[1]J.P Douliez, T Michon, K Elmorjani, D Marion Structure, biological and technological functions of lipid transfer proteins and indolines, the major lipid binding proteins from cereal kernels J. Cereal Sci., 32 (2000), pp. 1–20
[2]J.C Kader Lipid transfer proteins in plants Annu. Rev. Plant Physiol. Plant Mol. Biol., 47 (1996), pp. 627–654
[3]K.L Larsen, J.R Winther Surprisingly high stability of barley lipid transfer protein, LTP1, towards denaturant, heat, and proteases FEBS Lett., 488 (2001), pp. 145–148
[4]J.P Douliez, C Pato, H Rabesona, D Molle, D Marion Disulfide bond assignment, lipid transfer activity and secondary structure of a 7-kDa plant lipid transfer protein, LTP2 Eur. J. Biochem., 268 (2001), pp. 1400–1403
Structured Information
| Gene Name |
Os03g0111300 |
|---|---|
| Description |
Nonspecific lipid-transfer protein 2 (nsLTP2) (7 kDa lipid transfer protein) |
| Version |
NM_001055258.1 GI:115450244 GeneID:4331362 |
| Length |
476 bp |
| Definition |
Oryza sativa Japonica Group Os03g0111300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 3:630670..631145 |
| Sequence Coding Region |
630809..631099 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008396:630670..631145 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008396:630670..631145 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgatgaggaagttggcggtgttggtgttggcggtggcgatggtggcggcgtgcggcggcggcgtcgtgggtgtagcgggggccggttgcaacgctgggcagctgacggtgtgcacgggggcgatcgcgggcggggcgcggccgacggcggcgtgctgctccagcctgcgggcgcagcagggctgcttctgccagttcgccaaggacccgcgctacgggcgctacgtcaacagccccaacgcccgcaaggccgtctcctcctgcggcatcgccctccccacctgccactga</cdnaseq> |
| Protein Sequence |
<aaseq>MMRKLAVLVLAVAMVAACGGGVVGVAGAGCNAGQLTVCTGAIAG GARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH</aaseq> |
| Gene Sequence |
<dnaseqindica>47..337#gtacctcgcagcaccaagctagctagcttcgatcagtagctggaggatgatgaggaagttggcggtgttggtgttggcggtggcgatggtggcggcgtgcggcggcggcgtcgtgggtgtagcgggggccggttgcaacgctgggcagctgacggtgtgcacgggggcgatcgcgggcggggcgcggccgacggcggcgtgctgctccagcctgcgggcgcagcagggctgcttctgccagttcgccaaggacccgcgctacgggcgctacgtcaacagccccaacgcccgcaaggccgtctcctcctgcggcatcgccctccccacctgccactgatccatccatccatcgtctcctactcttttattttgtgatgtggtgtacgtgttcgtagtattgtcttggcgtcatctcgtcacgacgcgtatatgcatgcgcagtgcggcttttgaataaaaggggatcgaccgatgtt</dnaseqindica> |
| External Link(s) |
