Difference between revisions of "Os06g0100266"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Labs working on this gene)
Line 15: Line 15:
 
It is believed that the frequency of resistance genes in wild rice is 50 times higher than that in cultivated rice because it has undergone a long history of natural selection and contained rich genetic diversity  <ref name="ref1" /><ref name="ref4" />.
 
It is believed that the frequency of resistance genes in wild rice is 50 times higher than that in cultivated rice because it has undergone a long history of natural selection and contained rich genetic diversity  <ref name="ref1" /><ref name="ref4" />.
  
==Labs working on this gene==
+
==achievements on this gene==
Please input related labs here.
+
* Earlier studies on the inheritance of resistance to BLS in other cases also suggested some types of resistance to BLS are controlled by major genes (Zhang ''et al''. 1996; Xu ''et al''. 1997; Zhou ''et al''. 1999; Zhao ''et al''.2004).
 +
* The BLS resistance in rice has been proved to be a quantitative trait controlled by polygenes. (Zhang ''et al''. 1992; Khush 1977; Gnanamanickam ''et al''. 1999; Tang ''et al''. 2000)
 +
* Some major BLS resistance genes have also been identified (He ''et al''. 1996; Zhang ''et al''. 1996; Xu ''et al''. 1997; Zhou ''et al''. 1999).
 +
* 3 QTLs have been identified which confered the BLS resistance in rice. (Tang ''et al''. 2000)
 +
* In China, Peng ''et al''. (1982) found that the wild rice has high resistance to BLS.
 +
* Xu ''et al''. (1991) screened 2 017 rice accessions, which were derived from the generations of wild rice species, and identified 30 accessions highly resistant to BLS. Huang ''et al''.(2008) also identified 57 resistant accessions from 1655 accessions of wild rice resources.
  
 
==References==
 
==References==

Revision as of 06:07, 24 May 2014

Please input one-sentence summary here.

Annotated Information

The rice bacterial leaf streak (BLS)which has seriously constrained the rice production in humid tropical and subtropical areas of Asia and Africa.When rice is infected by the BLS pathogen, leaves become yellow or even blasted, the rate of unfilled grains will increase, and the grain weight will decrease. In recent years, some QTLs for BLS resistance have been mapped on rice genome using molecular markers.

Function

bls1, a BLS-resistance gene, from a rice line DP3, derived from the wild rice species Oryza rufipogon Griff [1]. The quantitative trait locus (QTL) qBlsr5a has been proved to have the largest effect on the resistance to rice bacterial leaf streak [2]. Li et al. 2008 have analyzed total proteins of leaves of rice cultivar 9311 which had been inoculated by ‘89773-1-1’, a kind of Xooc with strong pathogenicity, in order to find out some proteins associated with the resistance to this pathogen [3].They found that these proteins are involved in many resistant reactions associated with signal recognition and transduction, cell-wall reinforcement and biosynthesis of phytoalexins, etc[3].

Expression

According to the research, the BLS resistance in DP3 was controlled by recessive gene(s). To further confirm the inheritance pattern of BLS resistance, BC2F2 (9311/DP3//9311) populations were evaluated by JZ-8 strain inoculation. The damage severity scores of 307 individuals in BC2F2 population ranged from 0 to 9, and showed a pattern of bimodal distribution (Fig. 2). The segregation of resistant and susceptible plants well fitted in 1:3 ratio , suggested that a recessive gene, tentatively designated as bls1, conferred BLS resistance in DP3 [1].

Evolution

The common wild rice (O. rufipogon Griff.) is considered as wild ancestor of cultivated rice. The wild rice species with AA genome has been well recognized as a primary gene pool that conserves a lot of specific genes such as genes resistance to grassy stunt virus from annual wild rice [1]. It is believed that the frequency of resistance genes in wild rice is 50 times higher than that in cultivated rice because it has undergone a long history of natural selection and contained rich genetic diversity [1][4].

achievements on this gene

  • Earlier studies on the inheritance of resistance to BLS in other cases also suggested some types of resistance to BLS are controlled by major genes (Zhang et al. 1996; Xu et al. 1997; Zhou et al. 1999; Zhao et al.2004).
  • The BLS resistance in rice has been proved to be a quantitative trait controlled by polygenes. (Zhang et al. 1992; Khush 1977; Gnanamanickam et al. 1999; Tang et al. 2000)
  • Some major BLS resistance genes have also been identified (He et al. 1996; Zhang et al. 1996; Xu et al. 1997; Zhou et al. 1999).
  • 3 QTLs have been identified which confered the BLS resistance in rice. (Tang et al. 2000)
  • In China, Peng et al. (1982) found that the wild rice has high resistance to BLS.
  • Xu et al. (1991) screened 2 017 rice accessions, which were derived from the generations of wild rice species, and identified 30 accessions highly resistant to BLS. Huang et al.(2008) also identified 57 resistant accessions from 1655 accessions of wild rice resources.

References

Please input cited references here.

Structured Information

Gene Name

Os06g0100266

Description

Hypothetical protein

Version

NM_001187627.1 GI:297724384 GeneID:9267053

Length

7113 bp

Definition

Oryza sativa Japonica Group Os06g0100266, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:33130..40242

Sequence Coding Region

33130..33135,33283..33362,33749..33907,40200..40242

Expression

GEO Profiles:Os06g0100266

Genome Context

<gbrowseImage1> name=NC_008399:33130..40242 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:33130..40242 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggaagggcccaaagccagctcgtctgctctgggtgctgtaatctgctcatgtatccagccggagcaacgtcggtttgctgcacagccgctcgcgaagtacacactggagttgtgtgtgtctacgccgccgccggtggccgctgcggccatgaaggagtgtgtgcttgatgagtacgccaccaagcacaggatctccatcgataggtttctccagcttaggatatttgtcaaggtgcatgatcggcggcgcgtcggggcttccctgacttccagcactcctttctaa</cdnaseq>

Protein Sequence

<aaseq>MEGPKASSSALGAVICSCIQPEQRRFAAQPLAKYTLELCVSTPP PVAAAAMKECVLDEYATKHRISIDRFLQLRIFVKVHDRRRVGASLTSSTPF</aaseq>

Gene Sequence

<dnaseqindica>1..6#154..233#620..778#7071..7113#atggaagttttttttactactgtgttctgttgtctgaaatgaaaataatgcatggagaatgcttttgtcctctgaaaatgaaaatgctagctgctgaaatgtgacattcagtcagtctctgaactctgaagagccatgattgtgcaatttcaggggcccaaagccagctcgtctgctctgggtgctgtaatctgctcatgtatccagccggagcaacgtcggtttgctgcacagttcgtagtaccgtgaccgctgtgcctgctcccgatatgcacatcattcactcaggtttacatctcaacgttttttttgcaactaatgtggcatctgaaaattgagtttctttgcatctaaattttagagtagtttagaaatttatattgtatcctctctgttttatttacaaaaatgagtagtttttggtttttagagcagaaatctagctgcaatgttcacaaaaatgtaaagagagattaaaggggaacacaaccaacttccgggatccgcaacagcacgcgcgttgcgatgattgtgcctgcagtcaggtccctaatccgccgaccttagctatgtgattcatttttgtgttgctgtcatcagtgtttcacttgttctgtaggccgctcgcgaagtacacactggagttgtgtgtgtctacgccgccgccggtggccgctgcggccatgaaggagtgtgtgcttgatgagtacgccaccaagcacaggatctccatcgataggtttctccagcttaggatatttgtcaaggtgcatgatcggtaaggcctcatccatctccactagacgttgagcttcaagtgcgagcagacttgccactttcctgtattagatcagtagccgatgaatatgataatttcaactaagaaagttcgattgccgatctttatttatgtctttggcacaatgggggacatcctgatctatcatcataaatgctaactcactgaaattttggcacagctacttagtgacagcaaatttgatcttaatgcaatatgtcacccaaataatcttccaaaggttaccttgttcactaattgggagatgatttactgtatctttttcaatggaatagatgatttattgtatcataataacatctaatggttatttgcactctctcagggcttaaagtcactgcatacgtgaggtgctcgagcagtaggaatctgcatctaccatggatgatgttgctacataaacaaaacaatataattgctggtattattttcaacttttggtccttttgactctattaaattctttatccattactgtttctcgatagtttgttgtgaatgttgcctgcacattcaaatgatatgtgggattagtttccagtcactgaagtgcaaaccttagctagatctcttctgatgcagaaatctcactttttgtctgggtgaattctacacatttcagaccagaaaaatcttggtacaagtcttaatacaagccatttagttatcagcatatatattcactgtgtggtagctatactctaaaaaatattcaaagaaagtaggggtgcagtggttatgccgctgtttaataatctgctgaaggaaatagcaacattgcaaagaggtgcaaacggtgctacttgatgctgaaacctgagtaccagtcattttaattgtagctgtttgcagcaaagttttcgctaaatgtagtgcataaacttaatttatttttgccgcttgaaacttatatatacacaggcaactgtttttttttttcatttccaaaggcttccatccgtattaaccttgtttttttattaaagtattaaatttttggttagcagtattttgttatgtgttttagatttaatgcttctagaatatttctctatatgtattcatgttctatgaaaatgctatcttttggtgttccatgcaaagaggtatatatgtgaactgaatgttgcggttatttaaatattcacaatttgcacactcatgatctatttcagaaacttaaaaccaagtacccaatagttttgacaaatgaacactattttgtttgcacagaataaaaaatgtgatgatgctgttgggttgttattaaattgactaattgttttagcccttggtcccatccaaaaaaactggctttgcaagccaacacattcagtggttaacgagtagcatatttttatatataatgatattactaaatgtttgagagttttactttcatatatgtgccttacttatttatatatttcaggagtcttcttaaggattagattattgtcgttgaaaaaccatccactatagctgctacctctactcactttggcacaccatctaaaaatgcagagaagcaggttaatttatagtgggtgagcttaatccactgtagaaagcagaatatgaatgcaacaggctgcctgctatgattgatgctcatttattcagagattatcatttagcattctggtacttgatgagaagttataggtatccttctactttttttagtgaggcgatctaatttgaattttctcattcaatttgaggtttgtgacctgatttaagcccaacttttttctctttcaattctcatcatgtatgcctgcctggcatgtggttggcaatgtaagaaaatgttggatgtggttcatgtggcatgcaacaggccttggcctaagtgatgtctagcaggcagagcagataagattggttcagagatgttatttttcttccaccatcctttaattttcttctatttctttcttgaagtggatagaaccaattacttcatattataggtttatcttgcattgccctctccattcagttatctttaattcagttgtgtttcgaggcgtgctacagctcctgccttgtgggtttaattaggaatggaaatttcttactgatgcaggtttggtctcttctgtgcatggggtcaaccccaggatggtgatctgcatctatggcttccccaccaatgtcgctgccatctaggtacgaatcaattcagtccaatcatctcctctagcatctgttcttgatataggaaaaaaaagtatttttttggtagatcatgttatgtgatagtcgtccatgacctgttctacttccttcctcagcatttactgttgtaggtttccacattcactaggtttccatactcttaacacgcaagaagtagagcccaaggtttcttatatattttgcctgttctacaagaggattgagatgtttagtgtaatcctttgtgactcatggacaaaaccatgtaggtccttgttgatatatatggtgatccagaactccttgttgcatatggtattgttttttcttttcctttgtgcacacttagtttgtgaggcagttgattttgaccttcctttccatagaaaaaatatttccttttatgttgttttaaattccatgtgctaactcagatttattgtgattagttgttgttgtgctaatcttcaaatgtttagtatattttgtgcattttgatgctctattgctctgcaaaccatggcttttgaatgcactattttggttggacaggtaaatgtgttgtaggactattttagctaggattcataaactttgcactacacatcgctgctggtttttgtcctaaatagggacagttatttaggacataatttgaagattgaatttttctgctatttgaatcacaattgagttgctggtgataaatgttatccaaggcttgagtgctcgacactatttattatttcattctttttctgatattcctctagcaatttgcattaaaaagtttctgatatttctcaaaatgtacataaaataatctttagtcaaatcatgaattcgttgacgtgtgattggttatattgtacgaaacaatgctctctagcagtcatgcaaggtgttcaatacatgtgtcttggatattgaaactagattccatggtttacatctcaatttttttgccgcaccacatgagttaacctctttgcagcttgctgcatataatttacttgccacgattaattacccatacagcttaccacgaactaggggaataacctcattatggaaaatcaagacaactttcttaatgttgtatcttgatgtgcattcttttgaatctaggcttatttttatgcagttaaatttatgatttatactcctccaagttccatcagcccgctttgtataatattatgctttagatgggattagaggcctttcaaaggcagaaagagaaattatgctcctccagttggcctaggcttcaactctgggtttttatttctattgctggtcattcatacacaagatttcatgagcccacagttcaccttttggtcctacctcatttatcagcataggcgatagtagttgatgattatataccatttcccagactattccgaaagagcctaatgttggggatatttcaaggatgctaattgttgtaatgggtgcaagccatgttattaatgggtcatgaggaattagtctctgaccaaagtatctaaaaaatgctaagaaagaccaatttgtggtgctacttgatcccaagaaacaaggtgtacaggaagggaatgtgaaatcggtttctcactttttatggtagtcagtatctaaatcttacagtagaaaccaccttgaccgtgctgaaatggcatgagttattgaggctgctggtagaacacttgaaactttgcctcatttttgctgcttgatcttcatttcagccaattgcttgttagctatttagcttcatgttgcgattcatgttttgagcagcatttgtaaaatcatttatttaagaaagtggccatggacaagctcttttagatattgctaccttactatctttgggagagaaaaatgttgaatgaacattactagccatgatttggcaagaggccttcagattacgtgactattttgtattgatttgtacttgtgctattttgcttttcaagccaattacttctagaaatggatcactgagcctgtacacatgacacaataagagctaagcttttagcattctctgaaccctgactgcgacatagggtggctaatgaaatatgatcattagtaaatatgctgagtgcaataaactcttttccatgtaggcaaaaattttcttgtttgtaaaaattgtcatgtgcctagagctgagctctcttccgtggccaagatgtttctatagtttagtaagtggtatttcttggtagacgtttggctaatggaactcatgttctcagatattccaagatcttcagaagggaatagatcttggtgtagtctctccttagatgctacagatgttttttttaccttgagaaatgccctgttagggcatgtttaatggtagagacgagtatggtctcttaagcaatacaagattatttagagaccgtatctttacaatagtagagacgacaaagtctctaatcattaactcaaaaaatattccttttgttaatattctttccatttttttaccctcatgcaaccatatttccattttatattgattaagagtcgttgttaagctgttgttatgcatgacaacgatattttgtctctcctctttctctttcttccatgtcaacaagtattccaaattaacatcactaagagaccactattgacaaccattgtacatgcccttagtgcttcacagtttccaggtaagaaaatattcttttttttcccttcttagtgcttatcaattcttagtcttatgaataattctgttttaaacatagttatcctataattttgaggcagaatatacatacacttcatttcaataaaccaaatttcttagcggttgtgcaaaagattgctgggcagaccccaaattctcttctttttattatatatggctctcttgttcttctacattgataaacacacttttcagacaagttcttttgctcatggttttgcatactgcagatatccatagaagcaattgaagatttacaagtaaaacatgctttccataataacgcaaaatgttcctattattctggtgtgggtgtctgatgaaaggctttccttggaagtgcaactgtaggtacctatttctctcctttttttgtgagattacaaagtgccagacagacgcatatttctgcacatagttgtgtattcttgaacataggtctaggcttggtcagtattggatataattacatggtctgttttgtcacttccatggtataattgttttcttcaacttcctttttttttccaagcttagcaaaccttgtgacacaaggccacactaaactgcattagtgacatattatattaataaagacaaatatgtatatacacatgccactttgcgtttaggatgacagttttgtcaggtgttttgttacatagcaaagatttaattttttttattttatatttggctagccgtttgcgctttttcttacataaagtgttagtaggattaactaattaaattcataaaacactgtttgccacaatcatatatggtggcactctctattttccaatttagttagcataatgaaatgctcataattaatcctgtgctgaactaaattactatttgttagattactagccgttatttatgtatgcctgtttggttgttttattcacaaatctgtctcaattctctctttatttaatggaactgttctgacagtgcatgcatttcttattattcaggatggtgttcttcttgggatgaaatatcaaaacatatttttgatttgctttagctatgatacttcagcaagactcctggctgccttatctttttatataattgtcttgagcagttgtccctcaggtttttgcatagcttgtaggaacaagagtagagccatggaggcataatagcttgaagtaattatggttaatgtgcttacttaaaaaaggtgtttaatgttaacattgaattctgaaaacttgaagcagatttttctaagtgtacctggatgtttcttaagacatcggtttcttttgctatggtgctcctcgggagtatatacagccacaaaatcaaatgaactatatgcaggcggcgcgtcggggcttccctgacttccagcactcctttctaa</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0100266, RefSeq:Os06g0100266

  1. 1.0 1.1 1.2 1.3 Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. 3.0 3.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. Cite error: Invalid <ref> tag; no text was provided for refs named ref4