Difference between revisions of "Os08g0549100"

From RiceWiki
Jump to: navigation, search
(Function)
(Expression)
Line 9: Line 9:
 
===Expression===
 
===Expression===
 
Please input expression information here.
 
Please input expression information here.
 +
 
The expression analysis revealed that OsAPx4 gene present higher expression in leaves, but also is expressed in roots and panicles of rice.Analysis of the OsAPx4 promoter revealed expression in leaves, vascular button and panicle, mainly in the conducting vessels. In situ hybridization experiments in panicles showed expression in lemma and peduncle[3].Expression of the gene OsAPX4, coding for ascorbate peroxidase in leaves and roots of rice were induced by abiotic stresses, such as NaCl, NaHCO3 and Na2CO3, polyethylene glycol (PEG) 6000, H2O2, CuCl2[4]. Expression of OsAPX4 gene in yeast can enhance the resistance to salts(NaCl, NaHCO3). Trans-genic Arabidopsis over-expressing the OsAPX4gene also exhibited  growth  advantage  under  NaCl  and  NaHCO3 stress environments. These examinations imply that the OsAPX4 gene plays an important role in the response of plants to several environmental stress conditions[4].
 
The expression analysis revealed that OsAPx4 gene present higher expression in leaves, but also is expressed in roots and panicles of rice.Analysis of the OsAPx4 promoter revealed expression in leaves, vascular button and panicle, mainly in the conducting vessels. In situ hybridization experiments in panicles showed expression in lemma and peduncle[3].Expression of the gene OsAPX4, coding for ascorbate peroxidase in leaves and roots of rice were induced by abiotic stresses, such as NaCl, NaHCO3 and Na2CO3, polyethylene glycol (PEG) 6000, H2O2, CuCl2[4]. Expression of OsAPX4 gene in yeast can enhance the resistance to salts(NaCl, NaHCO3). Trans-genic Arabidopsis over-expressing the OsAPX4gene also exhibited  growth  advantage  under  NaCl  and  NaHCO3 stress environments. These examinations imply that the OsAPX4 gene plays an important role in the response of plants to several environmental stress conditions[4].
  

Revision as of 08:07, 24 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Plants use antioxidant enzymes such as superoxide dismutase (SOD), ascorbate peroxidase (APx), glutathione reductase (GR), and catalase (CAT)as well as antioxidants catalase (AsA) and glutathione (GSH) to scavenge ROS[1]. The involvement of H2O2 in HS- and Cd-mediated changes in the expression of APx and GR in leaves of rice Seedlings has been reported. APx plays an important role in scavenging and in protecting cells against the toxic effects of H2O2 in higher plants. APx is located in different cellular compartments. Eight types of APx in rice have been described for Oryza sativa: two cytosolic (OsAPx1 and OsAPx2), two putative peroxi-somal (OsAPx3 and OsAPx4), and four chloroplastic isoforms (OsAPx5, OsAPx6, OsAPx7, and OsAPx8)[2]. OsAPx4 gene has its function related to the functions assigned to the peroxisome and probably acts in the physiological processes regulation, such as senescence[3].

Expression

Please input expression information here.

The expression analysis revealed that OsAPx4 gene present higher expression in leaves, but also is expressed in roots and panicles of rice.Analysis of the OsAPx4 promoter revealed expression in leaves, vascular button and panicle, mainly in the conducting vessels. In situ hybridization experiments in panicles showed expression in lemma and peduncle[3].Expression of the gene OsAPX4, coding for ascorbate peroxidase in leaves and roots of rice were induced by abiotic stresses, such as NaCl, NaHCO3 and Na2CO3, polyethylene glycol (PEG) 6000, H2O2, CuCl2[4]. Expression of OsAPX4 gene in yeast can enhance the resistance to salts(NaCl, NaHCO3). Trans-genic Arabidopsis over-expressing the OsAPX4gene also exhibited growth advantage under NaCl and NaHCO3 stress environments. These examinations imply that the OsAPX4 gene plays an important role in the response of plants to several environmental stress conditions[4].

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

1.Department of Agronomy, National Taiwan University, Taipei, Taiwan, ROC

2.Stress Molecular Biology Laboratory (Key Laboratory of Ministry of Education), Alkali Soil Natural Environmenta Science Center (ASNESC), Northeast Forestry University 26 hexing Road, Harbin, 150040, China.

3.Departamento de Genética, Univ. Fed. Rio Grande do Sul, Porto Alegre, RS, 91501-970; Departamento de Bioquímica e Biologia Molecular, Univ. Fed. Ceará, Fortaleza, CE, 60455-970; Departamento de Botânica, Univ. Fed. Rio Grande do Sul, Porto Alegre, RS, 91501-970.

4.Department of Agricultural Chemistry and Institute of Biotechnology, National Taiwan University,Taipei, Taiwan, Republic of China; Department of Agronomy, National Taiwan University, Taipei, Taiwan, Republic of China

References

Please input cited references here.

1.Ting-Shao Chou;Yun-Yang Chao;Ching Huei Kao. Involvement of hydrogen peroxide in heat shock- and cadmium-induced expression of ascorbate peroxidase and glutathione reductase in leaves of rice seedlings. Journal of Plant Physiology, 2012, 169(5): 478-486

2.Chwan-Yang Hong;Yi Ting Hsu;Yu-Chang Tsai;Ching Huei Kao. Expression of ASCORBATE PEROXIDASE 8 in roots of rice (Oryza sativa L.) seedlings in response to NaCl. Journal of Experimental Botany, 2007, 58(12): 3273-3283

3.Ribeiro,CW; Garighan,J; Rosa,SB. Functional characterization of the rice peroxisomal ascorbate peroxidase. IV SIMPOSIO BRASILEIRO DE GENETICA MOLECULAR DE PLANTAS,2013

4.Qingjie Guan;Dexi Xia;Shenkui Liu*. OsAPX4 gene response to several environmental stresses in rice (Oryza sativa L.). African Journal of Biotechnology, 2010, Vol.9(36): 5908-5913

Structured Information

Gene Name

Os08g0549100

Description

Similar to Peroxisome type ascorbate peroxidase

Version

NM_001068974.1 GI:115477686 GeneID:4346247

Length

3979 bp

Definition

Oryza sativa Japonica Group Os08g0549100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 8

Location

Chromosome 8:27643339..27647317

Sequence Coding Region

27643575..27643781,27644123..27644225,27644321..27644400,27644492..27644574,27645146..27645194
,27645275..27645340,27645501..27645550,27646009..27646133,27647089..27647201

Expression

GEO Profiles:Os08g0549100

Genome Context

<gbrowseImage1> name=NC_008401:27643339..27647317 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:27643339..27647317 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccgccccggtcgtggacgccgagtacctccgccaggtcgacagggcgcgccgccacctccgcgccctcatctcctccaagggatgcgcgcccatcatgctccgcctcgcatggcatgacgcgggcacttatgacgtgaacacaaaaactggtggtgcaaatggttcaattagatacgaggaagagtacactcacggttcaaatgctggtctaaagattgctattgatcttctcgagcctattaaagccaagagccctaagatcacatatgctgacctttatcagcttgctggagttgttgcagttgaagttactgggggtccaactgttgagttcattcctggaagacgtgattcgtcagtttgcccccgtgaagggcgtcttcctgatgctaagaaaggtgcactgcacttgagggacatcttttaccggatgggcttatcagacaaagatatagtagctttatctgggggtcacactctgggaagggcacatcctgaaaggtctggatttgaaggcgcatggactcaggagcctctgaagtttgacaattcgtactttcttgagctactgaagggggaatctgaggggcttctgaagctcccaactgacaaggcattgttggaagatccttcatttagacgctatgtggatctttatgccagggatgaagacaccttcttcaaggactacgctgaatcgcacaagaagctttctgaacttggcttcactccacggagcagcggccctgcatctacgaaatctgatctttcaactggtgctgtactcgcacagagtgctgtcggggtagctgttgctgcagctgtagttatcgtgagctacctatacgaggcttctaagaagagcaagtaa</cdnaseq>

Protein Sequence

<aaseq>MAAPVVDAEYLRQVDRARRHLRALISSKGCAPIMLRLAWHDAGT YDVNTKTGGANGSIRYEEEYTHGSNAGLKIAIDLLEPIKAKSPKITYADLYQLAGVVA VEVTGGPTVEFIPGRRDSSVCPREGRLPDAKKGALHLRDIFYRMGLSDKDIVALSGGH TLGRAHPERSGFEGAWTQEPLKFDNSYFLELLKGESEGLLKLPTDKALLEDPSFRRYV DLYARDEDTFFKDYAESHKKLSELGFTPRSSGPASTKSDLSTGAVLAQSAVGVAVAAA VVIVSYLYEASKKSK</aaseq>

Gene Sequence

<dnaseqindica>3537..3743#3093..3195#2918..2997#2744..2826#2124..2172#1978..2043#1768..1817#1185..1309#117..229#agtgagtactagtcacaccacacgcttggcttgacgccgcacgcctccgctccgctccgccgccgcggccgatctctctagggcttccaacctcgccggcgacgcgacgccacgccatggccgccccggtcgtggacgccgagtacctccgccaggtcgacagggcgcgccgccacctccgcgccctcatctcctccaagggatgcgcgcccatcatgctccgcctcgcgtacgtacctaccggcctaccccccatctcctgctcctcctagaaccctcccctagttcctaatccttgtgatggattcgcgcggcggtggcgagggagggagctctcgtgtgtttggatttggagcccgctcggctctgcttgcctcgagtggtgggatgagttactgctggtggtggtgagatgggtcgcttgcgattgcgagactgtatgattgggtttggttagttgcttgcggcgggtacctgcgctggtccgtggcgtggctgttgggcgaggcaattcgacgaacaccttgagtgcgtgcgcgcctgctttggatggctcccagatttggttttgattgtgtgactgcgcctttggaattaacgaggaacggcggacgatgtttagttcgctagttcacatgtagagtgcacgcgtttttctgttgatccgttggttctctcatactagtcaggaaactagcaacctagcaggggagagcgagcatttttaatcactccccatattccgtcataacggcaatatcgcaggaagctaagacgaatttcttatttctgtctatagtaggtgttccactccatgagcttcgtgttacatttgtggagctgatgagagaccagtgttacaaactggaacaaataagtgatgtttcattatctaaaaaaaggggatgtttgcactactgctgcaaatgttctatgtatattgtaattacgaatggactcagaagaagcattaccatttaacgcaccattacagatagtgcagcgtgtatttgctaattaattagtactttatatatggaattgtgattttttttatcttatatgttgtatacagtgttcttctgtaatgtactatgagtttttctcatttatcatggaggatattctgcgtgctcttggattactcttggactaaaacttagttcctgtgcactcccttgcagatggcatgacgcgggcacttatgacgtgaacacaaaaactggtggtgcaaatggttcaattagatacgaggaagagtacactcacggttcaaatgctggtctaaagattgctattgatcttctcggtatgtattgtttgtccccaatgtgttcctagatgattagacgaaagtagctttcacttttcccccattgtcagaatggctctagttccctttaaaccactcatcagctatatgattgatgcctcttaagaaatcaatttgagttttcttgtcagtttctcaaaattcttttctttttctattgttttgggttttaccttgatcggactacaaactaactcttttttttctctaattcggggatcaaatattttgggagaaataactaaaaaacaagaaactcccatatttttgcaactattctcaatggtgttgcagtactcaccactcttctctgtacaattgcattatttacctgttccacgttatctagtttattgttatattgtcactttattcagtgatgaaataaatcgaatgattacttatgcttctccaattgtcttttactgtaacagagcctattaaagccaagagccctaagatcacatatgctgacctttatcaggtaaattagcgttgcttgaattggttcttgtgctgccaacttattataagagtgccttgatactgtgacatcttttttttttcttgtcgcacatttgatcttttttatcttatcgattactgtgtaaatttttaagatcctaactagatttttcttacagcttgctggagttgttgcagttgaagttactgggggtccaactgttgagttcattcctggaagacgtgtacgtgaaataacatttctttatgaatggatgcatcttttattgattcacacttattaagttcttttgacctgaatcaggattcgtcagtttgcccccgtgaagggcgtcttcctgatgctaagaaaggtaattgccacaaactattctttgaactggtctaccttttcttttgtcattataatcatgcttcctgactcctagtgtttgaagcaatgagtcaaaatatgtgttagtattctacatgtatcacatttagtcccatgcatttctcctgtacttgtctgctagtactcatgttctggcatttagtacttagtgttgcttgagacaacccagttcatgcaatacataccgtaatatgtacattatcttaaacacacatacatctcttcatagatgggagcctcgtctttcatttatcttatattcctgcatatctggtatagttgtcatttaggtgtcataccagcaggtgctgttgtatgtctggtaatttgttttatgttatttatctgttttcctattccttctgccgaagtctgttttcctttcttacatttactgggatgcaaggtgccagttcctattttagtattttaataactggtgccagaatcctgttttgatatgtataatcgtaatcatatatctatttttatgggggtatatctgcattttatctttgtttcatgagcaggtgcactgcacttgagggacatcttttaccggatgggcttatcagacaaagatatagtagctttatctgggggtcacactctggtaaatgctctaattaatgtagaatttgtgtaatggtaatcctgattcttcatgagaagcacagttttaacaactcgctttatacttcaagggaagggcacatcctgaaaggtctggatttgaaggcgcatggactcaggagcctctgaagtttgacaattcgtactttctgtaagttgaatacaaaactgggtcatttacgtactaattctgggcactagatttgaggttagaagataacagtgtaatattttatttaactgcagtgagctactgaagggggaatctgaggggcttctgaagctcccaactgacaaggcattgttggaagatccttcatttagacgctatgtggatctttatgccagggtaaaaaggatcttttatatatatattttttttctattccttgcacttaaaactcccccattttatatgccctttcatccattttttaggactataggaccattaacaaactataaagtatttgaatttgttagttgaaaatgcaattaatagatttatttattgtcaaatatgatttcggagcattatatttttacaacttttactgctatataattggaagtgaataattttcaaaatgctacaagaactgtgaatatttcatgccgacgtactatgccttgcggtgctccataatataagttttacattcagaaccatttcttctgttcatatggcaggatgaagacaccttcttcaaggactacgctgaatcgcacaagaagctttctgaacttggcttcactccacggagcagcggccctgcatctacgaaatctgatctttcaactggtgctgtactcgcacagagtgctgtcggggtagctgttgctgcagctgtagttatcgtgagctacctatacgaggcttctaagaagagcaagtaagattgctatgttcttcatcagcatggcctcatagtaagtatcagggtcaaataacagaattctagtgatgatccagccatacgaacacttccttcatgtctacatataccctatcaatatttcatggggaattatatggagatgacatagcttcactatttaaaagcactttggacatatattattccgtcttctgtgtgctctctaatatctacaagaacagtggtttgtgtcct</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0549100, RefSeq:Os08g0549100