Difference between revisions of "Os03g0227700"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Annotated Information)
Line 2: Line 2:
 
''OsDWAR''F4 is expressed in young elongating tissues.
 
''OsDWAR''F4 is expressed in young elongating tissues.
 
==Annotated Information==
 
==Annotated Information==
 +
OsDWARF4 is a homolog of A. thaliana DWARF4, which encodes a cytochrome P450, CYP90B1 (Fig. 1a). CYP90B1/DWARF4 catalyzes C-22 hydroxylation, the rate-limiting step of brassinosteroid biosynthesis[11]. Only one DWARF4 homolog was identified in the rice genome. OsDWARF4 is located on the short arm of chromosome 3 (35 cM). Its predicted open reading frame consists of eight exons, and encodes a protein of 502 amino acids (Fig. 1b,c). OsDWARF4 is most closely related to DWARF4 (66.3% amino-acid identity; Fig. 1a). The structure of OsDWARF4 is similar to that of DWARF4 throughout its length: five domains found in cytochrome P450s—proline rich, A (also referred to as dioxygen binding), B (steroid binding), C and heme binding—are highly conserved (Fig. 1c). In wild-type rice, OsDWARF4 transcripts are most abundant in leaf blades and roots, but are also found in all other plant parts tested (Fig. 1d). Transcript levels were decreased by exogenous brassinolide treatment, and increased in brassinosteroid-insensitive d61-3 and brassinosteroid-deficient brd1-1 (Fig. 1e). These results suggest that OsDWARF4 expression is feedback regulated, as is that of A. thaliana brassinosteroid-biosynthesis genes[12].
 
   
 
   
 
===Function===
 
===Function===
New cultivars with very erect leaves, which increase light capture for photosynthesis and nitrogen storage for grain filling, may have increased grain yields. Here we show that the erect leaf phenotype of a rice brassinosteroid-deficient mutant, osdwarf4-1, is associated with enhanced grain yields under conditions of dense planting, even without extra fertilizer. Molecular and biochemical studies reveal that two different cytochrome P450s, CYP90B2/OsDWARF4 and CYP724B1/D11, function redundantly in C-22 hydroxylation, the rate-limiting step of brassinosteroid biosynthesis. Therefore, despite the central role of brassinosteroids in plant growth and development, mutation of OsDWARF4 alone causes only limited defects in brassinosteroid biosynthesis and plant morphology[1].
+
New cultivars with very erect leaves, which increase light capture for photosynthesis and nitrogen storage for grain filling, may have increased grain yields.The erect leaf phenotype of a rice brassinosteroid-deficient mutant, osdwarf4-1, is associated with enhanced grain yields under conditions of dense planting, even without extra fertilizer. Molecular and biochemical studies reveal that two different cytochrome P450s, CYP90B2/OsDWARF4 and CYP724B1/D11, function redundantly in C-22 hydroxylation, the rate-limiting step of brassinosteroid biosynthesis. Therefore, despite the central role of brassinosteroids in plant growth and development, mutation of OsDWARF4 alone causes only limited defects in brassinosteroid biosynthesis and plant morphology[1].
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
Brassinosteroids influence both plant height and leaf erectness in rice[6]. Arabidopsis thaliana BRASSINOSTEROID INSENSITIVE1 (bri1) mutants, which are deficient in the brassinosteroid receptor, have a severe dwarf phenotype[7]. The rice mutants d61-1 and d61-2, which are weak mutant alleles of OsBRI1, a homolog of A. thaliana BRI1, have both a semi-dwarf phenotype and more erect leaves[8]. In rice, an erect leaf phenotype has also been associated with loss-of-function, brassinosteroid-deficient mutants such as brassinosteroid-deficient dwarf1 (brd1), which is defective in OsDWARF (the homolog of tomato CYP85A1/DWARF[9]), and ebisu dwarf (d2), which is defective in CYP90D2/D2 (ref. [10]). However, the grain yield of d61, brd1 and d2 mutants is decreased because of morphological alterations in their reproductive development.
  
 
===Evolution===
 
===Evolution===

Revision as of 11:41, 24 May 2014

Please input one-sentence summary here. OsDWARF4 is expressed in young elongating tissues.

Annotated Information

OsDWARF4 is a homolog of A. thaliana DWARF4, which encodes a cytochrome P450, CYP90B1 (Fig. 1a). CYP90B1/DWARF4 catalyzes C-22 hydroxylation, the rate-limiting step of brassinosteroid biosynthesis[11]. Only one DWARF4 homolog was identified in the rice genome. OsDWARF4 is located on the short arm of chromosome 3 (35 cM). Its predicted open reading frame consists of eight exons, and encodes a protein of 502 amino acids (Fig. 1b,c). OsDWARF4 is most closely related to DWARF4 (66.3% amino-acid identity; Fig. 1a). The structure of OsDWARF4 is similar to that of DWARF4 throughout its length: five domains found in cytochrome P450s—proline rich, A (also referred to as dioxygen binding), B (steroid binding), C and heme binding—are highly conserved (Fig. 1c). In wild-type rice, OsDWARF4 transcripts are most abundant in leaf blades and roots, but are also found in all other plant parts tested (Fig. 1d). Transcript levels were decreased by exogenous brassinolide treatment, and increased in brassinosteroid-insensitive d61-3 and brassinosteroid-deficient brd1-1 (Fig. 1e). These results suggest that OsDWARF4 expression is feedback regulated, as is that of A. thaliana brassinosteroid-biosynthesis genes[12].

Function

New cultivars with very erect leaves, which increase light capture for photosynthesis and nitrogen storage for grain filling, may have increased grain yields.The erect leaf phenotype of a rice brassinosteroid-deficient mutant, osdwarf4-1, is associated with enhanced grain yields under conditions of dense planting, even without extra fertilizer. Molecular and biochemical studies reveal that two different cytochrome P450s, CYP90B2/OsDWARF4 and CYP724B1/D11, function redundantly in C-22 hydroxylation, the rate-limiting step of brassinosteroid biosynthesis. Therefore, despite the central role of brassinosteroids in plant growth and development, mutation of OsDWARF4 alone causes only limited defects in brassinosteroid biosynthesis and plant morphology[1].

Expression

Brassinosteroids influence both plant height and leaf erectness in rice[6]. Arabidopsis thaliana BRASSINOSTEROID INSENSITIVE1 (bri1) mutants, which are deficient in the brassinosteroid receptor, have a severe dwarf phenotype[7]. The rice mutants d61-1 and d61-2, which are weak mutant alleles of OsBRI1, a homolog of A. thaliana BRI1, have both a semi-dwarf phenotype and more erect leaves[8]. In rice, an erect leaf phenotype has also been associated with loss-of-function, brassinosteroid-deficient mutants such as brassinosteroid-deficient dwarf1 (brd1), which is defective in OsDWARF (the homolog of tomato CYP85A1/DWARF[9]), and ebisu dwarf (d2), which is defective in CYP90D2/D2 (ref. [10]). However, the grain yield of d61, brd1 and d2 mutants is decreased because of morphological alterations in their reproductive development.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

1. Sakamoto T;Morinaka Y;Ohnishi T;Sunohara H;Fujioka S;Ueguchi Tanaka M;Mizutani M;Sakata K;Takatsuto S;Yoshida S;Tanaka H;Kitano H;Matsuoka M

 Erect leaves caused by brassinosteroid deficiency increase biomass production and grain yield in rice
 Nature Biotechnology, 2006, 24(1): 105-109

Structured Information

Gene Name

Os03g0227700

Description

Cytochrome P450 family protein

Version

NM_001055982.2 GI:297600576 GeneID:4332134

Length

6529 bp

Definition

Oryza sativa Japonica Group Os03g0227700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:6765109..6771637

Sequence Coding Region

6765109..6765374,6765543..6765867,6765971..6766123,6768937..6769188,6769337..6769429
,6770222..6770300,6770398..6770504,6771392..6771637

Expression

GEO Profiles:Os03g0227700

Genome Context

<gbrowseImage1> name=NC_008396:6765109..6771637 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:6765109..6771637 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccgccatgatggcgtccataaccagcgagctgctcttctttctccccttcatcctccttgccctgctcacgttctacaccaccaccgtggccaaatgccacggcgggcactggtggcgaggtgggacgacgccggcgaagaggaagcggatgaacctgccgcccggcgccgccgggtggccgctcgtcggcgagacgttcggctacctccgcgcccaccccgccacctccgtcggccgcttcatggagcagcacatcgcacggtacgggaagatataccggtcgagcctgttcggggagcggacggtggtgtcggcggacgcggggctcaaccggtacatcctgcagaacgaggggaggctgttcgagtgcagctacccgcgcagcatcggcggcatcctgggcaagtggtccatgctggtcctcgtcggggacccgcaccgcgagatgcgcgccatctccctcaacttcctctcctccgtccgcctccgcgccgtcctcctccccgaggtcgagcgccacaccctcctcgtcctccgcgcctggcccccttcctccaccttctccgctcagcaccaagccaagaagttcacgttcaacctgatggcgaagaacataatgagcatggacccgggggaggaagagacggagcggctgcggcgggagtacatcaccttcatgaagggcgtggtctccgcgccgctcaacctgcccgggacgccctactggaaggctctcaagtcgcgtgctgccattctcggagtaatagagaggaaaatggaagagcgggttgagaagctgagcaaggaggatgcaagcgtagagcaagacgatcttctcggatgggctctgaaacaatctaacctttcaaaagagcaaatcctggacctcttgctgagcttgctcttcgccgggcacgagacgtcgtccatggcgctcgccctcgccatcttcttccttgaaggctgccccaaggctgtccaagaactgagggaggagcatcttgggattgcaaggagacaaaggctaagaggggagtgcaaattgagctgggaagactacaaagagatggttttcacgcaatgtgtcataaacgagacgttgcggctaggaaacgtggtcaggttcctgcaccggaaggtcatcaaggacgtgcactacaagggttatgacattccaagcggatggaagatcctgccggtgttagccgcggtgcatctggactcgtccctgtacgaggacccccagcgcttcaatccctggagatggaagagtagcggatcatccggcggcttggctcagagcagcagcttcatgccgtacggcggcgggacgcggctgtgcgccgggtcggagctcgcgaagctggagatggccgtgttcttgcaccacctggtgctcaacttcaggtgggagctcgccgagccggaccaagccttcgtcttccccttcgtcgacttccccaagggccttcccattagggttcatagaattgcacaggatgatgagcaggagtaa</cdnaseq>

Protein Sequence

<aaseq>MAAMMASITSELLFFLPFILLALLTFYTTTVAKCHGGHWWRGGT TPAKRKRMNLPPGAAGWPLVGETFGYLRAHPATSVGRFMEQHIARYGKIYRSSLFGER TVVSADAGLNRYILQNEGRLFECSYPRSIGGILGKWSMLVLVGDPHREMRAISLNFLS SVRLRAVLLPEVERHTLLVLRAWPPSSTFSAQHQAKKFTFNLMAKNIMSMDPGEEETE RLRREYITFMKGVVSAPLNLPGTPYWKALKSRAAILGVIERKMEERVEKLSKEDASVE QDDLLGWALKQSNLSKEQILDLLLSLLFAGHETSSMALALAIFFLEGCPKAVQELREE HLGIARRQRLRGECKLSWEDYKEMVFTQCVINETLRLGNVVRFLHRKVIKDVHYKGYD IPSGWKILPVLAAVHLDSSLYEDPQRFNPWRWKSSGSSGGLAQSSSFMPYGGGTRLCA GSELAKLEMAVFLHHLVLNFRWELAEPDQAFVFPFVDFPKGLPIRVHRIAQDDEQE</aaseq>

Gene Sequence

<dnaseqindica>1..266#435..759#863..1015#3829..4080#4229..4321#5114..5192#5290..5396#6284..6529#atggccgccatgatggcgtccataaccagcgagctgctcttctttctccccttcatcctccttgccctgctcacgttctacaccaccaccgtggccaaatgccacggcgggcactggtggcgaggtgggacgacgccggcgaagaggaagcggatgaacctgccgcccggcgccgccgggtggccgctcgtcggcgagacgttcggctacctccgcgcccaccccgccacctccgtcggccgcttcatggagcagcacatcgcacggtcggtggtttcattactcggtacacgcacacagctatataagcacgcgcactgctcgcctcgccgtgaagcaagcttagctagtagctaggatatcgatcgatcggtaataataggctgacggcgagctggggggtggcgtgcggttgcgtgcgtgcgtgcatgcaggtacgggaagatataccggtcgagcctgttcggggagcggacggtggtgtcggcggacgcggggctcaaccggtacatcctgcagaacgaggggaggctgttcgagtgcagctacccgcgcagcatcggcggcatcctgggcaagtggtccatgctggtcctcgtcggggacccgcaccgcgagatgcgcgccatctccctcaacttcctctcctccgtccgcctccgcgccgtcctcctccccgaggtcgagcgccacaccctcctcgtcctccgcgcctggcccccttcctccaccttctccgctcagcaccaagccaagaaggtacaacacacatcgtcctccattaagttgagcatgcatatatcaatcagctcgctctagcgatcaatatcaatgaaacgcgcgtttgcgtgcgtgcgtgcagttcacgttcaacctgatggcgaagaacataatgagcatggacccgggggaggaagagacggagcggctgcggcgggagtacatcaccttcatgaagggcgtggtctccgcgccgctcaacctgcccgggacgccctactggaaggctctcaaggtacgtactcgtagctactagctactccctccgtttcgaaatgtttgacgccgttgactttttatcacatatttgaccgttcgttttatttaaaaaaattaagtaattattaattattttcctatcatttgattcattgttaaatatatttttatgtaggcatataattttacatatctcacaaaagtttttaaataagacgaacggtcaaacatttgctaaaaagtcaacggtgtcaaatatttcgaaacggaggaagtagctagctaccaccccacccgtgcggattgatcgatcgatcgatgtccctctctgcctacacacaccctgcgccccggccgtacgcgcgcaaagtcgtgcgcgcatgagttttactccttccgtttcaaaaaaaaaacgacctagacaagtaatatgatgtaacctagaacaacgaatctatacaggagtatatccaaattcattgtcctagattacatcatatctttgtctatgttgccttttttaggaggagagagtactttacatatgagttatgaccggccggccaggttcctttcttcccctattccgtatgcatactataagcagctgcatataggcatatactactatacccagcttagctaaagcaaacaacttgcaacgacgatcatgtgcaggtccctgttgacagaggttagagatgtaaaccatttttgttgttttcattatctaaagagaaaacaagttactacgacgatcgagatgtacgcaaggggatcatatttatattggagaggagagagagatgatttgcgacttgtgagtgataagtgaatatatatactatatatttgtgtaggagtgacgatgacttccctgtcaatgttttgtttggtatgcacacggggggaaaagagtttagagaaaggaattggctagagagggccaggtttagtttctttaatttttgtttggtggttttgtgtgtagctagtccgcatgcatgatatatcatatatatgcatggcccatcattagatatatatacatgacggcagtgcacttattatatatatgtaggggcatatacaaggtgtatgtgtttagaattgtggatggtccaggaattgttgcagctagttctatactagcatagtgaattagtgatccatatcgagatcaggtccaatcggtcagctcgcacagcgggtcttttagtacgatttgttcggacaaattatcttgcctttgagataatcaacataggattgaaactgcatactagcaatagaccatagctatttggcaatatagaaagctaaaaaatgttgattgaaaggtgcgtgcatgcatgctagcagtatgtcttttaggccaggtccagtttttttttttttctcaaaggcagttgcttaaggtgaaattctagcagaggtcatatgaatatatttattatcttccaaacatgagccaaaacctatatatagttaactcaaaaaaccatgcattggtacttcttctgagtatgcatcctggggactgatcgatcatgcagattcttttctttctttttccctggggacgtactgatcatcactcatgtgagcataaaatgttgcctactttttactgcatgtgaggtcacactcaaatgatctttattgattgcctcagcatgcatgctgctagctttcacgatctctctccgatacacacaccctgtgctgtgctcaacagcatgcaacctggcaggtggaatttttaatctgttggaaagtaaatgaccaaccttcataatttggcatgattatatgctggggaatctatcatttatcatgattcaaccgctgaccaaactctttgccacacacccgaaccacattaatttcgttaagcggatgattagccagcaaccttcacagtttggttttaattagttaatgaaagggtgcttgtagttttattagctgaagagacactgcagtactcctactgagcgttctccttaattgggaaatagatctctgcagtactatcctttaactttaagtgaataacatgtagctaggtctcacacttatcaggcccacacatcagtgatccaagtcaaatggcaatacaccataggagattcttccactaattggctaacaaaaataaactgtgatcactgatcacagctgctaacactataacacattaatttgcatgtctcatgaaatgccagatgagttggattaattatctatcttatgttcagtgccgaggaatatacaaggaaacatcattggtatagttgtggagttctgagtgcattatctcacccagtacggtcaaattaatcctagtctccgtaaatatggttgtgtgcactcttagttaattagtgtagacccggaaattatactttgtcgagaatgttgttatccgtgtgttaagtttcaagtaccctgcaggcctataactaaacactgccaacatggatgtttaagaatgaattatacatacagcgcacttggaaaagaaaaggggtagctacccagctgaagaacacctctctctcatttgaaggtcgacacaatatgtgtcttttctatatcgaaaggaaacgacattttttctcttcaaaacagaaagctatgacaagagacataatcctagactagtaggcggttaggcaacaccatatctgaatttgataggtgtcccacatattttttttcttttcctgataagaaggaacttttcaccgtgagcttatttttttctgttctatgtcgacattagttccatgatgtttactgtgtatttttactgttcccctgcagtcgcgtgctgccattctcggagtaatagagaggaaaatggaagagcgggttgagaagctgagcaaggaggatgcaagcgtagagcaagacgatcttctcggatgggctctgaaacaatctaacctttcaaaagagcaaatcctggacctcttgctgagcttgctcttcgccgggcacgagacgtcgtccatggcgctcgccctcgccatcttcttccttgaaggctgccccaaggctgtccaagaactgagggtacagagaattacagattcgaaattaacatctactgtcactagctcagtgctacgtttaactgtagagcaacaattgcagaaagcgaaggcatcagaaatgacatgggaatcgattagttacactcacactgacgcgtgacatgcaggaggagcatcttgggattgcaaggagacaaaggctaagaggggagtgcaaattgagctgggaagactacaaagagatggttttcacgcaatgtgtaaggccccccctactttgttccttccgatccctcctccctaaacgctactaatataaatcggtgcaaaggctttgtgctagcgtagctcttgctgttttgtttggtcacttgcgtagagagatagcaacttcccgaaatgtcatgtacgaatggagactgaaagctctgcgaaataattgccgggccacgtactacagtacttacgctccctctcttcagtttggatcgatcgagctaagaaggcgcacgcatgtgtgcattgatcgatagagtcgatctgttctgccttgtaagctagccagctgaggttctttcgccttggaagtttctacagggtgaggcccatcgtcttgcaacgatccaaatgccatgacaagtacctgttgttgtaggcttccagtagcacggcctgcccccaagaaggtatctgaatcttctgcattgctgttcagacggcagagcagaacatgccgaaataccattccagtcagttgcagtatatgtgtgtggtggtatcagataaaggagcagagtaatttgaggccttagaaattcagatgagttgctcgacaattgtcgcctaccgatcgagaataagttgcatgcatgtatgtgatgtaattatgggtcttagtcagcaggatagtttagtcgctgcagtactgtagattgtagtacttgcgttcaaagcagacccaaaacagaacttgcattcaggaaacaaaacatgaaaaaagaaatatacagtacttggcactgatatttcttttgtttgggtccttattgcaggtcataaacgagacgttgcggctaggaaacgtggtcaggttcctgcaccggaaggtcatcaaggacgtgcactacaagggtgagtagctcgatttcactcttcttccctgaatcgacctctcctctatctgacagcagaagctaactgaactgaactgaactgaactgaactgaaggttatgacattccaagcggatggaagatcctgccggtgttagccgcggtgcatctggactcgtccctgtacgaggacccccagcgcttcaatccctggagatggaaggtcagtcgcagtaggattatcagtgaatctaatctattaatctcggtttaattgctgggattcaaggaaaagaaaatactgggacaagcgcggatgtcgctgttgggcagtgtctgtcaatcataagcgaaggggatcatgtcagaatctgcaaaagcagcacaggctaaacgcgtgcttgcctcgagcagcaatcatgcagagaggcaagctccgcgataggaacatgcatggtgaatcactgaacctgatatgaaagtgaatgctcagctcagctcgctcgctcgcgcgcgcatgtgctttctcatttcgccgtgttgcgtgctagctagtcaatggtgttcccacgaattgttttctcttctcatcacacaaagtcagtggtgaaaaccgaggtgcatgtgcggtaatggaacgggggattaggcggcgacgccgtgatggattatgcattcgtgcgagaaaaatccaggagcgttggtccaaatcgcaagcggatcaaaccgaaccaatcagtggacgattggagccctgcagtccatccatcacatctccattcttatccgctgcgactcacggacattagttgttgaggggtgaacgacgcatgtgtgtatgtatgctcgatcgatcgatcgaacaatggatctgtgtgtggtgtagttgccaacgccgacgagattatctgctcgtctgcatgcagccgcgaaaaagacatgtgtccggattatcctgcaggagattgagcaagataatctgctgcgcaaaaactgcagccaatcgatcattccatgacgcgaaaaaaaaaacaataattactactgctgatacgataacttcgcttcgaattgttgacacacaagtgttcttcttttgttcgattgcagagtagcggatcatccggcggcttggctcagagcagcagcttcatgccgtacggcggcgggacgcggctgtgcgccgggtcggagctcgcgaagctggagatggccgtgttcttgcaccacctggtgctcaacttcaggtgggagctcgccgagccggaccaagccttcgtcttccccttcgtcgacttccccaagggccttcccattagggttcatagaattgcacaggatgatgagcaggagtaa</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0227700, RefSeq:Os03g0227700